KEGG   Marinovum algicola: MALG_00161Help
Entry
MALG_00161        CDS       T03981                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
malg  Marinovum algicola
Pathway
malg00564  Glycerophospholipid metabolism
malg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:malg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MALG_00161
Enzymes [BR:malg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MALG_00161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox Pyr_redox_2 FAD_binding_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AKO95374
UniProt: A0A0H4KSM1
LinkDB All DBs
Position
complement(172499..174094)
Genome map
AA seq 531 aa AA seqDB search
MSHHDTDGPTDLFVIGGGINGCGIARDAAGRGLSVTLAEMNDLASATSSSSTKLFHGGLR
YLEYFEFRLVREALIERETLLRAMPHISWPMRFILPYHKDMRFESETPTSRLLGLFMPWM
KGRRPAWLIRLGLFMYDHLGGRKILPGTRTLSLNDSKEGAPLQDRFDKAYEYSDCWVEDS
RLVVLNARDAEARGARILTRTKVLSAVREGDLWRVETQNTENGEIQTHLARMLINAGGPW
VGDIIQTKVRINSREGVRLVRGSHIVTKRLYDHDKCYFFQGTDGRIIFSIPYETDFTLIG
TTDADHPDPSQKPVCTAEEQRYLIDFANQYFAKALSRDDIVWTYSGVRPLYDDGASSATA
ATRDYTLKVDAEGGAPVLNVFGGKITTYRRLAESALEQIDSHLNVGKGPWTAGVPLPGGD
FPVDGVERMIADLQSQYGFLTDFWARRLVRAYGTDAAVMLGAAQTAQDLGRDFGATLTET
EVVWLMTREYARTAEDVVWRRNKLGLRMSEAEIENLQDWMAENRRSSTAAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcatcacgacacagatggcccgacagacctgttcgtcatcggcggcggcatcaat
ggctgcggcattgcccgcgacgccgccggccgcgggctgagcgtcacactggccgagatg
aacgatctcgcctcggccacctcgtcgtcatctaccaagctgtttcacggcggcctgcgc
tatctggaatacttcgagtttcggctggtacgcgaggcgctgatcgaacgcgaaaccctg
ctgcgcgcgatgccgcacatcagctggcccatgcgttttatccttccatatcataaggat
atgcggtttgaatcggaaacgccgacgtcccggctgctcggacttttcatgccctggatg
aaaggtcgccggccggcctggctcatccgtctcgggcttttcatgtatgatcatctgggc
gggcgcaaaatcctgccgggcaccagaaccctgtcgctgaacgacagcaaggaaggcgcg
ccgcttcaggatcggttcgacaaggcctatgaatattccgattgctgggtcgaggattcg
cggcttgtcgtgctcaacgcccgcgatgccgaagcccggggcgcccggatcctgacccgg
accaaggtgctttctgcggtgcgcgagggtgacctctggcgcgtggaaacgcaaaacacc
gaaaacggcgagattcagacccacctcgcccgcatgctgatcaatgcgggcggcccttgg
gtcggcgacatcatccagaccaaggtgcggatcaattcgcgcgagggcgtgcgcctggtg
cgcggcagtcatatcgtgactaagcggctctatgaccacgacaaatgctatttcttccag
ggcaccgacgggcggatcatcttttcgatcccctatgagaccgatttcaccctgatcggc
accaccgatgccgatcaccccgatccgtcgcaaaaaccggtctgcaccgcggaagaacag
cgctacctgatcgactttgccaaccagtatttcgccaaggccctcagccgggacgatatc
gtctggacctattccggcgtgcggccgctttatgacgatggcgcctcgagcgccacggcg
gcgacgcgggattacacgctgaaggtcgatgccgaaggcggcgcgccggtgctcaacgtc
tttggcggcaagatcaccacctatcgccggctggcggaaagcgcgctggagcagatcgac
agccacctgaacgtcggcaaaggcccctggacggcgggcgtgccgctgcccggcggcgat
ttcccggtcgatggcgtcgaacgcatgatcgccgacctgcaatcgcaatacggctttctc
accgatttctgggcgcgccggctggtgagggcctatggcaccgacgcggccgtcatgctg
ggcgcggcgcagacggcccaggatctcggccgcgacttcggtgccacgctgaccgaaacc
gaggtggtctggctgatgacccgtgaatacgcacgcaccgcggaagacgtggtgtggcgg
cgcaacaaacttggcctgcgcatgagcgaagccgagattgaaaacctacaagactggatg
gcggaaaaccgtcgatccagcacggctgccgcttaa

DBGET integrated database retrieval system