KEGG   Marinovum algicola: MALG_00733Help
Entry
MALG_00733        CDS       T03981                                 

Definition
(GenBank) Threonine dehydrogenase
Organism
malg  Marinovum algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 HI0933_like AlaDh_PNT_C FAD_binding_2 FAD_oxidored Pyr_redox TrkA_N DAO 3HCDH_N Pyr_redox_3 AdoHcyase_NAD FAD_binding_3 2-Hacid_dh_C GIDA
Motif
Other DBs
NCBI-ProteinID: AKO95928
UniProt: A0A0H4L586
LinkDB All DBs
Position
732808..733842
Genome map
AA seq 344 aa AA seqDB search
MTDTQIHAAFYRGDRRFDVAQKPAPAPGPGQVALRIAFCGICGTDMHVFHGNMDARVGFE
RIIGHEMSGTVEALGAGVEGFTEGQKVVVRPLDHCGDCPACDAGHTHICHNLKFLGLDTD
GAMQEVWNVPAHTLHVLPDDMRLDHAALIEPVAVACHDVRMAGLKEGEDVVVIGGGPIGV
LVAMVAREAGGKVVISEVNENRLAIAADMGFDVVNPAKSDLVAEIGNRTGGKGADVVFEV
SGSQPGVDAMTDVAATRGRICMVAIHAKKPQVDMFRFFWRELQLIGARVYEAADYDKAIA
LVASGAIAADKVITDVSPLAEIQRAFEQLDASPTALKSLIKVGA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacccagatccatgccgccttttaccggggcgaccggcgctttgacgtcgcc
cagaagccggccccggcgcctgggccgggccaggttgccctgcgcatcgccttttgcggc
atctgcggcaccgacatgcatgtctttcacggcaacatggacgcccgcgtcggatttgaa
cgcatcatcggccatgagatgtcgggcacggtcgaggcgcttggcgctggtgtcgaaggc
ttcaccgaggggcaaaaggtcgtcgtgcggccgctggatcattgcggcgactgcccggcc
tgtgacgccggccacacccatatctgccacaacctgaaatttctcggcctcgacaccgat
ggtgcgatgcaggaggtctggaacgtgccggcccataccctgcatgtccttcccgatgac
atgcggctcgaccatgcggcgctgatcgagccggtggcggtggcctgtcatgatgtccgc
atggccggcctgaaggaaggcgaggacgtggttgtcatcggcggcggcccgatcggcgta
ctggtggcgatggtcgcgcgcgaggcgggcggcaaggtggtgatctccgaggtcaatgaa
aaccgtctggcgattgccgccgacatgggctttgacgtggtgaacccggccaaatccgac
ctggttgccgaaatcggcaatcgcaccggcggcaagggcgccgacgtggtgtttgaagtg
tcgggcagccagcccggcgtcgatgcgatgaccgatgtggccgccacccgcgggcgtatc
tgcatggtggcgatccacgccaagaaaccgcaggtcgacatgttccgctttttctggcgc
gagttgcagctgatcggtgcgcgggtctacgaggcggcggattacgacaaggcgatcgcg
ctggtggcctcgggcgcgattgctgctgacaaggtgatcaccgatgtcagccccttggcc
gagatccagagggccttcgaacagctcgatgcttcgccgaccgcgctgaagagcctgatc
aaggtgggggcctga

DBGET integrated database retrieval system