KEGG   Marinovum algicola: MALG_01097Help
Entry
MALG_01097        CDS       T03981                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
malg  Marinovum algicola
Pathway
malg00970  Aminoacyl-tRNA biosynthesis
malg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MALG_01097
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:malg03029]
    MALG_01097
Enzymes [BR:malg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MALG_01097
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MALG_01097
Mitochondrial biogenesis [BR:malg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MALG_01097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AKO96285
UniProt: A0A0H4KRY3
LinkDB All DBs
Position
complement(1112856..1114367)
Genome map
AA seq 503 aa AA seqDB search
MLDLTYETPKPKMIAGAKHDWELVIGMEVHAQVSSQAKLFSGASTQFGAEPNANVAFVDA
AMPGMLPVINEYCIEQAVRTGLGLKAQINLKSAFDRKNYFYPDLPQGYQISQLYEPLVGE
GEVLVEMGDGTARKVRIERIHVEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIRG
PEEAAAYVVKLRQILQYLGTCDGNMQNGNLRADVNVSVCLPGQYEKYQATQDFSHLGTRC
EIKNMNSMRFIQQAIDYEAKRQIAILEAGGSIDQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQGWVDDIRNTLPELPDEKKARFIADYGLSDYDASVLTSETASANYFEK
VAEGRDGKMAANWVINELFGRLKKEDHALADSPVSPEQLGGIIALIQKGDISGKIAKDLF
EIVYTEGGDPAQIVEARGMKQVTDTGAIETAVDEVIAANPAQVEKAKANPKLTGWFVGQV
MKATGGKANPKAVNEIVSAKLGL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctggacctgacatatgagacccccaaacccaagatgatcgccggggcgaaacacgat
tgggagctggtgatcggcatggaggtccatgcccaggtgtcctctcaggccaagctgttt
tccggcgcatcgacgcaattcggcgccgagcccaatgccaatgtcgcctttgtcgatgcg
gcgatgcccggcatgttgccggtgatcaacgaatattgcatcgaacaggcggtgcgcacc
gggctgggcctcaaggcgcagatcaacctgaagagcgccttcgaccgcaagaactacttc
tatcccgacctgccgcagggctatcagatcagccagctctacgagccgctggtgggcgaa
ggcgaagtgctggtcgagatgggcgacggcaccgcgcgcaaggtgcggatcgagcgcatc
cacgtcgagcaggacgccggcaaatcgatccacgacatggatcccaacatgtccttcgtc
gatctcaaccgcaccggcgtggcgctgatggagatcgtcagccgtcccgacatccgcggc
cccgaggaagcggcggcctatgtggtcaagctgcgccagatcctgcaatatctcggcacc
tgcgacggcaacatgcaaaacggcaacctgcgggccgatgtcaacgtctcggtctgcctg
ccgggccagtacgagaaataccaggcgacgcaggatttcagccatctcggcacccgctgc
gagatcaagaacatgaactcgatgcggttcatccagcaggcgatcgattacgaggccaag
cgtcagatcgccatcctggaggccggcggatcgatcgatcaggaaacccggctctacgat
cccgacaagggcgagacccggtcgatgcggtcgaaggaggaggcgcatgattatcgctac
ttccccgaccccgacctgctgccgctggagatcgaacagggctgggtggacgacatccgg
aacaccctgcccgagctgccggacgaaaagaaggcgcggttcatcgccgactacggcctg
tccgattacgacgcctcggtgctgacctccgaaaccgcctcggccaattacttcgagaag
gtggcggaaggccgtgacggcaagatggcggccaactgggtgatcaacgaactcttcggc
cggctgaaaaaggaagaccacgcgctggccgacagcccggtctcgccggaacagctcggc
ggcatcatcgcgctgatccagaagggcgacatctcgggcaagatcgccaaggatctgttc
gagatcgtctataccgagggcggcgatccggcgcagatcgtcgaagcccgcggcatgaag
caagtcacagacaccggcgccatcgaaacggcggtggacgaggtgatcgccgccaacccg
gcgcaggtcgagaaggccaaggccaaccccaagctcaccggctggtttgtcggccaggtg
atgaaggccaccggtggcaaggccaaccctaaggcggttaacgagatcgttagcgccaag
ctggggctctga

DBGET integrated database retrieval system