KEGG   Marinovum algicola: MALG_01141Help
Entry
MALG_01141        CDS       T03981                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase, prokaryotic type
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
malg  Marinovum algicola
Pathway
malg00250  Alanine, aspartate and glutamate metabolism
malg00280  Valine, leucine and isoleucine degradation
malg00410  beta-Alanine metabolism
malg00640  Propanoate metabolism
malg00650  Butanoate metabolism
malg01100  Metabolic pathways
malg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:malg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MALG_01141
   00650 Butanoate metabolism
    MALG_01141
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MALG_01141
   00280 Valine, leucine and isoleucine degradation
    MALG_01141
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MALG_01141
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:malg01007]
    MALG_01141
Enzymes [BR:malg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MALG_01141
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MALG_01141
Amino acid related enzymes [BR:malg01007]
 Aminotransferase (transaminase)
  Class III
   MALG_01141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKO96329
UniProt: A0A0H4KV76
LinkDB All DBs
Position
complement(1163993..1165435)
Genome map
AA seq 480 aa AA seqDB search
MTASTKPRASRAANKDKKTAARKPAAKPAAKSAAKPVSTPVVAQTGSNAALLARREAAVP
RGVASAAPVFAARAENAELWDVEGKRYIDFAGGIAVLNTGHRHPKVIEAAKAQEDLYTHT
SFQVVPYEPYVALAEKLNELAPGDFAKKTLLVTTGAEAVENAVKIARAHTGRPGVIAFNG
SYHGRTLLTLGMTGKISPYKKDVGPFPSDIFRAPFPDARQGVTVEDSLKALEMLFLTDAQ
PDRVAAIILEPVLGEGGYHPVPAEMFQALRAICDRHGILLISDEIQAGFGRTGTWFAIEH
SGVAPDLITCAKSMAGGYPVAGVIGRAEVMDAMAPGGLGGTYGGNPVACAAALAAIEAIE
SEGLLARSTALGEMFKARFAEIGARVAPYRMWDIRGLGAMIAVEFVTDFDTAAPDAALTK
AVIAKALDKGLILLACGMHGNALRIMVPLTASDAILEEAMVIFEAALAEAIAEQHALAAE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgactgccagcaccaaaccgcgcgccagccgggccgcgaacaaggacaagaaaaccgcc
gcacgcaagcccgcggccaaacccgcagccaaatctgccgccaagccggtcagcacgccc
gttgttgcgcagaccggcagcaacgccgcgcttctggcccgtcgcgaggccgcggtgccg
cgcggtgtcgcctctgccgcgccggtctttgccgcccgtgccgagaatgccgagctctgg
gatgtcgagggcaagcgctacatcgatttcgccggcggcattgccgtgctgaacaccggg
caccgtcaccccaaggtcatcgaggccgccaaggcgcaggaagacctctatacccacacg
tcgttccaggtcgtgccttatgagccttacgtcgcgctggccgaaaagctgaacgaactg
gcgccgggtgatttcgccaagaagacgctgctggtcaccaccggcgccgaggcggtcgag
aacgctgtcaagatcgcccgcgcccataccggccgccccggcgtcattgccttcaacggc
tcttaccatggccgcaccctgctgacgctgggcatgaccggcaagatcagcccctacaag
aaagacgtcggccccttcccctccgacatcttccgcgcgcccttccccgacgcgcgtcag
ggcgtgaccgtcgaggacagcctcaaggcgctcgagatgctgtttctcaccgatgcccag
cctgaccgcgtggcggcgatcatcctcgaaccggtgctcggcgaaggcggctatcacccg
gtcccggccgagatgttccaggccctgcgcgcgatctgcgaccggcatggcatcctgctg
atctctgacgagatccaggccggtttcggccgcaccggcacctggtttgcgatcgagcat
tccggcgtcgcgcccgatctgatcacctgtgccaaatccatggccggcggctatcccgtg
gccggtgtgatcggccgggccgaggtgatggatgcgatggcccccggcggccttggcggc
acctatggcggcaacccggtcgcctgcgccgcggcgctggcggcgatcgaggcgatcgaa
agcgagggattgctcgcccgctcgaccgctctgggcgaaatgttcaaggcccgctttgcc
gagatcggcgcccgggtcgcgccctaccggatgtgggacattcgcggccttggcgcaatg
atcgcggtggaattcgtcaccgatttcgacaccgccgcgcccgacgccgcgctgaccaag
gcggtgatcgccaaggcgctggacaagggtctgatcctgctggcctgcggcatgcatggc
aacgccctgcgcatcatggtgccgctgaccgcatcggatgcgatcctcgaggaagccatg
gtgatcttcgaagccgcgctggccgaggccatcgccgaacagcacgcgctggcggcggaa
taa

DBGET integrated database retrieval system