KEGG   Marinovum algicola: MALG_02717Help
Entry
MALG_02717        CDS       T03981                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
malg  Marinovum algicola
Pathway
malg00240  Pyrimidine metabolism
malg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MALG_02717
Enzymes [BR:malg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MALG_02717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: AKO97872
UniProt: A0A0H4KUR3
LinkDB All DBs
Position
complement(2786362..2786955)
Genome map
AA seq 197 aa AA seqDB search
MAKLYFHYSTMNAGKSTLLLQAAHNYRERGMEVYLMTAQLDSRAGPARIGSRIGIGCDAV
TYAPGEDLLAHVEARLAEGPLACIFLDEAQFLEPAQVWQLAHVVDDLKVPVMCYGLRVDF
QGQLFPGSATLLALADEMREVRTICHCGKKATMVVRQNEQGEVLTEGAQVQIGGNETYVS
LCRKHWRAATGAGQARG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctattttcactattccactatgaacgcggggaaatcgaccctgctgctt
caggcggcgcacaactatcgcgaacgcggcatggaagtctatctgatgaccgcgcagctt
gacagtcgcgccggcccggcgcgcatcggctcgcgcatcggcatcggctgcgacgcggtg
acctatgcgccgggcgaggacctgctggcgcatgtcgaggcgcgtctggccgaggggccg
ctggcctgtatcttcctcgacgaggcacagtttctcgaaccggcacaggtctggcagctg
gcgcatgtggtggatgacctcaaggtgccagtgatgtgctacggcttgcgggtggatttc
cagggccagctgtttcccggctcggccacgcttttggcgctggccgacgagatgcgcgag
gtgcgcaccatctgccattgcggcaagaaggccaccatggtggtgcggcagaacgaacag
ggcgaggtactgaccgagggggcccaggtccagatcggcggcaacgagacctatgtgagc
ctctgccgcaagcattggcgcgccgccaccggcgcggggcaggcgcgcggctag

DBGET integrated database retrieval system