KEGG   Marinovum algicola: MALG_02736Help
Entry
MALG_02736        CDS       T03981                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
malg  Marinovum algicola
Pathway
malg00020  Citrate cycle (TCA cycle)
malg00190  Oxidative phosphorylation
malg00650  Butanoate metabolism
malg01100  Metabolic pathways
malg01110  Biosynthesis of secondary metabolites
malg01120  Microbial metabolism in diverse environments
malg01130  Biosynthesis of antibiotics
malg01200  Carbon metabolism
Module
malg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
malg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
malg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:malg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MALG_02736
   00650 Butanoate metabolism
    MALG_02736
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MALG_02736
Enzymes [BR:malg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MALG_02736
    1.3.5.4  fumarate reductase (quinol)
     MALG_02736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_16 Fer2 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AKO97891
UniProt: A0A0H4KY38
LinkDB All DBs
Position
complement(2808388..2809167)
Genome map
AA seq 259 aa AA seqDB search
MVQLTLPKNSRIKTGKTWPKPEGATNVRKFQIYRWSPEEGGNPTVDTYFLDMDKCGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGINTLACIYGLDEISGDVKIYPLPHMP
VVKDLIPDLTHFYAQHASIMPWLETKTNRPAKEWKQSIEDRKKLDGLYECVMCASCSTAC
PSYWWNGDKYLGPAALLHAYRWIIDSRDEATGERLDDLEDPFKLYRCHTIMNCTKTCPKG
LNPAEAIAHIKKMMVERAV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtacaactgaccctccccaagaattcccgcatcaagaccggcaagacctggcccaag
cccgagggcgcgaccaatgttcgcaagttccagatctatcgctggagcccggaagagggc
ggcaatcccacggtcgacacctatttcctcgacatggacaaatgcgggccgatggtgctc
gacgcgctgatcaagatcaagaacgagatcgacccgacgctgaccttccgtcggtcgtgc
cgcgaaggcatctgcggctcctgcgcgatgaacatcgacgggatcaacacgctggcctgt
atctacggcctcgacgagatcagcggcgacgtgaagatctatccgctgccgcatatgccg
gtggtcaaggatctgatccccgatctgacgcatttctatgcccagcacgcctcgatcatg
ccctggctggagaccaagaccaatcgcccggccaaggaatggaagcaatcgatcgaggac
cgcaagaagctcgacgggctttatgaatgcgtgatgtgcgcgtcctgctcgacagcctgc
ccgtcttattggtggaacggcgacaaatacctcgggccggcggcgctgctgcatgcctat
cgctggatcatcgacagccgcgacgaggccacaggcgagcggctggacgatctggaggat
ccgttcaagctctatcgctgccacaccatcatgaactgcaccaagacctgccccaagggg
ctgaacccggcggaggcgattgcccacatcaagaagatgatggtcgaacgcgcggtctga

DBGET integrated database retrieval system