KEGG   Marinovum algicola: MALG_02739Help
Entry
MALG_02739        CDS       T03981                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
malg  Marinovum algicola
Pathway
malg00020  Citrate cycle (TCA cycle)
malg00190  Oxidative phosphorylation
malg00650  Butanoate metabolism
malg01100  Metabolic pathways
malg01110  Biosynthesis of secondary metabolites
malg01120  Microbial metabolism in diverse environments
malg01130  Biosynthesis of antibiotics
malg01200  Carbon metabolism
Module
malg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
malg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
malg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:malg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MALG_02739
   00650 Butanoate metabolism
    MALG_02739
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MALG_02739
Enzymes [BR:malg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MALG_02739
    1.3.5.4  fumarate reductase (quinol)
     MALG_02739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AKO97894
UniProt: A0A0H4KZI9
LinkDB All DBs
Position
complement(2809772..2811580)
Genome map
AA seq 602 aa AA seqDB search
MTAAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAAS
LSNMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQ
RPFGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKQKAEFYVEYFAIDLLMSEDG
ACQGVLCWKLDDGTMHVFNAKTVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQD
MEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTM
EIREGRGVGEDGDHIHLNLSHLPPEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYN
MGGIPTNYWGEVLNPTADDPNRVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAA
IRAGKVVDAESAVPTAPKAEIDKAFDRFDGLRNAKGGTPTAELRLEMQKTMQEDAAVFRT
AETLSQGVEKMTKIAAKLDDLHVTDSSLIWNSDLMETLELTNLMPNALATIVGAEARKES
RGAHAHEDHPKRDDENWRVHTIATVDGTKVDLSFRPVVKDPLTTEDEGGIALKRIAPKER
TF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagcttacgaatacgagacgcatgattatgacgtcgttgtggtgggcgccggc
ggtgctggcctgcgcgcgacgctgggcatggccgaacagggcctgcgcaccgcctgtgtg
accaaggtctttccgacccgctcgcataccgtggcggcgcagggcggtatcgccgcttcg
ctttccaacatgggccccgaccactggcagtggcacatgtatgacacggtcaagggctcc
gactggctcggcgacaccgacgcgatggaatacctcgcgcgcgaggcgcccaaggcggtc
tatgaactcgagcactacggcgtcccgttctcgcgcaccgaggaaggcaagatctaccag
cgtcccttcggcggccacaccaccgagtttggcgaaggcccggccgtgcagcgcacctgc
gccgccgccgaccgcaccggccatgccatcctgcacacgctctacggccagtcgctgaag
cagaaggccgagttctacgtcgaatatttcgccatcgacctgttgatgagcgaggacggc
gcctgtcagggcgtgctctgctggaagctcgacgacggcaccatgcatgtcttcaacgcc
aagaccgtggtgctggccaccggcggctatggccgcgcctatttctccgccacttcggcc
cacacctgcaccggcgacggcggcggcatggtggcccgcgcgggcctgccgcttcaggac
atggagttcgtccagttccaccccaccggcatctacggctccggctgcctgatcaccgaa
ggcgcgcggggcgagggcggatacctcaccaactccgaaggcgagcgcttcatggagcgc
tatgcaccgcaatacaaggacctggcgccgcgcgattacgtgagccgctcgatgaccatg
gaaatccgcgaaggccgcggcgtcggtgaggacggggatcacatccacctcaacctgtcg
catctgccgcccgaggcgctggccgaacgcctgccggggatttccgagagcgccaagatt
tttgccggtgtcgatgtcacgaaagaaccgatcccggttctgccgacggtgcattacaac
atgggcggcattccgaccaactactggggcgaggtgctcaaccccaccgcggatgacccc
aaccgcgtggttcccggcctgatggccgtgggcgaggccggttgcgcctcggtgcatggc
gccaaccgcctcggctcgaactcgctgatcgacctggtggtctttggccgcgccgccgcg
atccgtgccggtaaggtggtcgacgccgagagcgcggtgccgactgcgcccaaggccgag
atcgacaaggccttcgaccggttcgacgggcttcgcaacgccaagggcggcacgccgacg
gccgagcttcggctcgaaatgcagaagaccatgcaggaggacgccgccgttttccgcacc
gccgagaccctgtcgcagggtgtcgagaagatgaccaagatcgccgccaagcttgacgat
ctgcatgtcaccgacagctcgctgatctggaactccgatctgatggagacgctggagctg
accaacctgatgcccaatgcgctggccactatcgtcggcgccgaggcgcgcaaggaaagc
cgtggcgcccatgcccatgaggatcaccccaagcgtgacgacgagaactggcgggtacac
accatcgccacggtcgatggcaccaaggtcgatctcagcttccgcccggtggtcaaggac
ccgctgaccacagaagacgagggcggtatcgcgctgaaacggatcgcgcccaaggaaagg
acgttctga

DBGET integrated database retrieval system