KEGG   Marinovum algicola: MALG_03069Help
Entry
MALG_03069        CDS       T03981                                 

Definition
(GenBank) Threonine dehydrogenase
Organism
malg  Marinovum algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc Pyr_redox_2 NADH_4Fe-4S MoCF_biosynth UDPG_MGDP_dh_N Pyr_redox_3 AdoHcyase_NAD HI0933_like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AKO98215
UniProt: A0A0H4KXP8
LinkDB All DBs
Position
complement(3133739..3134752)
Genome map
AA seq 337 aa AA seqDB search
MKALVYTGPKSVEIRDTARPGPKPGEVLLKMQLCGVCGTDIGIHSGTHPRAAAPLILGHE
FVGGVVEAGARFARGQRVVAYPLLSCGVCHPCRTGSPHVCTGLRLIGIDQAGGLAEYLSV
PEDMLFAVPEDMDNRIAALVEPLAVALRTVEQSGLGLADRVAVLGAGPIGLLTALAARQA
GAAEVLVSDIDPVRLALAGVLGFRPVDLRQDDLSEQVQAATDGDGVDVVFECAGVGPAAR
DMTRIARPGGTICLTSLHKAPCPVALLDIAFKELRLIGSRVYTREQFRRSITLAQAMAED
LERVITRTLPLSGSAHVFDLIAAPEEADVKILIDCTA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctcttgtctacaccggcccgaaatcggtcgagatccgggacaccgcccggccc
gggccgaagccgggcgaagtgctgctgaagatgcagctctgtggcgtctgcggcaccgat
atcggcatccattccggcacccatccacgcgccgccgcgccgctgatcctcgggcatgag
ttcgtcggcggggttgtcgaagccggcgcccgctttgccagggggcaacgggtcgtggcc
tatccgctgctgtcctgcggcgtctgccacccctgccgcaccggcagcccgcatgtctgc
accggcctgcgcttgatcggcatcgatcaggcgggcggactggcggaatacctgtcggtg
cccgaggatatgctctttgcggtgcccgaggatatggacaatcgcatcgccgcgctggtc
gagcctctggcggtggcgctgcggacggtcgagcaatcgggcctggggcttgccgaccgg
gtggcggtgctgggcgccgggcccatcgggctgctgacggcgcttgcggcgcgccaggcc
ggcgcggccgaggtgctcgtctccgatatcgatccggtgcgactggcgctggccggggtg
ctcggctttcggcccgtcgatctgcgccaggacgacctgtccgagcaggttcaggcggcg
accgatggcgacggcgtcgatgtggtctttgaatgcgccggggtcggccccgccgcgcgc
gacatgacccggattgcccggccgggcggcacgatctgtttgacgtcgctgcacaaggcg
ccctgtccggtggcgttgctcgacattgccttcaaggagctgcgcctgatcggctcgcgg
gtctatacccgcgaacaattccgccgcagcattactctggcacaggcgatggccgaggat
ctggagcgggtgatcacccggacgctgccgctgagcgggtctgcccatgtctttgacctg
atcgccgcgccggaggaggcggatgtgaagattctgatcgattgcaccgcctag

DBGET integrated database retrieval system