KEGG   Marinovum algicola: MALG_03070Help
Entry
MALG_03070        CDS       T03981                                 

Definition
(GenBank) Dehydrogenase with variable specificity
Organism
malg  Marinovum algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase RmlD_sub_bind 3HCDH_N 3Beta_HSD Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AKO98216
UniProt: A0A0H4KYX7
LinkDB All DBs
Position
complement(3134771..3135541)
Genome map
AA seq 256 aa AA seqDB search
MSGAADSGAWAAPFLSGRQVLVTGGSSGIGRSIAQAFAQAGAEVVATGVAEADITAARDW
AEAEGLGASLSFRQLDVRDDAAVAREVGGIADLFALVCCAGVIRRGAELEPEVFAQVVDV
NLNGAMRCAHAAKPALARTGGSVVMTASMLSFFGGGLVPGYSASKGGVAQLTKSLAIAWA
AEGIRVNAIAPGWIRTPLTAGLQEDAARAEAILSRTPMGRWGEPGDLAGPSLFLTTPLAG
FMTGTILPVDGGYAVA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggcggcagacagcggcgcctgggcggcgcctttcctttcgggccggcaagtc
ctggtgaccggaggctcctcgggcatcggccgcagcattgcgcaggccttcgcccaggcc
ggcgccgaggtggtggcgaccggtgtggccgaagccgacatcacggcggctcgcgactgg
gccgaggcggaggggctgggcgccagtctctctttccgccagcttgacgtgcgcgacgat
gcggcagtggcccgagaggtcggcggcattgcggatctcttcgcattggtctgttgcgcc
ggggtgatccggcggggcgccgaattggagccggaggttttcgcccaggtggtcgacgtc
aacctcaacggcgcgatgcgttgtgcccatgcggcgaaaccggcgctggcgcgcaccggc
ggctccgtggtgatgaccgcctcgatgctgtcgttctttggcggcgggctggtgccgggc
tattccgcgtccaagggtggtgtagcgcagctcaccaagtcgctagccatcgcttgggcg
gcagagggcatccgcgtcaacgccatcgcgccgggctggatcaggacaccgctgacagcc
ggcttgcaggaagacgcggcgcgcgccgaggcgatcctgtcgcggaccccgatgggccgc
tggggcgagccgggcgatctggccggtccctcgctgttcctgaccacgccgctggccggt
ttcatgaccggcacgatcctccccgtggacggcggctatgcggtcgcctga

DBGET integrated database retrieval system