KEGG   Marinovum algicola: MALG_03071Help
Entry
MALG_03071        CDS       T03981                                 

Definition
(GenBank) hypothetical protein
Organism
malg  Marinovum algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_7 Cupin_2 DUF4437
Motif
Other DBs
NCBI-ProteinID: AKO98217
UniProt: A0A0H4KVW0
LinkDB All DBs
Position
complement(3135541..3136080)
Genome map
AA seq 179 aa AA seqDB search
MPVEPDKVEAQDDARTPYQLPFPKDAAEEIVVPEAIASDERVWVPQTETVSFRPLCLNAS
QGYWMNLLRVRQSGVLSRHRHPQPVHGFVLKGRWHYLEHDWEAREGGYVYEPPGETHTLV
VPEDVTEMITFFQVNGVMLYVDPYGKTMGFEDVFTKIEMCRNHYEEVGLGADYVDQFIR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcgaacccgataaagtggaagcgcaggacgatgcgcgtaccccctatcaactg
ccttttcccaaggatgccgcggaagagatcgtcgttcccgaggcgatcgccagcgatgaa
cgcgtctgggtgccgcagaccgaaacggtgtccttccggccgctctgcctcaacgcctcg
cagggctactggatgaacctgctgcgggtgcgccaatccggcgtgctgtcgcgtcaccgc
catccgcagccggtgcatggctttgtcctcaaaggccgctggcactatctggaacatgac
tgggaggcccgcgaaggcggctatgtctacgagccgccgggcgagacccatacgcttgtg
gtgcccgaggatgtgaccgagatgatcaccttcttccaggtcaacggcgtgatgctttat
gtcgatccctacggcaagaccatggggttcgaagacgtcttcaccaagatcgagatgtgc
cgaaaccactatgaagaggtggggctgggggcggattacgtcgaccagttcatccgctga

DBGET integrated database retrieval system