KEGG   Marinovum algicola: MALG_03131Help
Entry
MALG_03131        CDS       T03981                                 

Definition
(GenBank) Arabinose efflux permease
Organism
malg  Marinovum algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AKO98276
UniProt: A0A0H4KZ34
LinkDB All DBs
Position
complement(3195735..3196910)
Genome map
AA seq 391 aa AA seqDB search
MNAGLILLTLSYVFSQFFRSFLAVLAEVLERDIGARPDDLATASGVWFLVFALMQIPVGA
ALDRIGPRRTAAVLFAIGGAGGAAGFALAQSPVHVTLAMGLIGLGCSPVLMASYYIFART
CRPAIFASLAATVLGIGTLGNLAGTLPLTLLVEAIGWRETLWALAAASAAIAFGLFFLVR
DPPGAETTLRGSVLDLLRLPALWLVIPMMFVNYAASGGLRALWIGPYLRDVHGLTPGAIG
LATLAMGVAMIAGTFAYGPLDRWFGSRKWVVLPGNALVVMGCTALWLWPAPGVVTVLALF
CIVGFFGMTFPLILAHGRSYAPDHLIGRGVTLMNLFGIAGVGIFQVVTGRVQEGAAAQGP
IEASYAPVFAIFALVTLAGMIPYLFSRDRLD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccggtctgatcctgctgacgctgagctatgtgttcagccagttctttcgctcg
ttccttgccgtgctggccgaggtgctcgaacgtgacatcggcgcccgccccgatgacctc
gccaccgcctcgggcgtctggtttctggtctttgcgctgatgcagatcccggtcggcgcg
gcgctggatcggatcgggccgcgccgcaccgccgcggtgctctttgccatcggcggcgcc
ggcggcgcggcggggtttgccctggcgcagagcccggtgcatgtgactctggccatgggg
ctgatcgggctgggctgttcgccggtgctgatggcctcctattacatcttcgcgcgcacc
tgccggccggcgatctttgcctccctggcggccacggtgctgggcatcggcactctgggc
aacctcgccggcaccctgccactcaccctgctggtcgaggccatcggctggcgcgagacg
ctctgggcgctggcggcggcctcggcggcgatcgcgtttggcctgttcttcctggtgcgc
gacccgcccggcgccgaaaccaccctccgcggctccgtgctcgacctgctgcgcctgccg
gcgctctggctggtcattccgatgatgttcgtcaactacgccgcctcgggcgggctgcgg
gcgctctggatcgggccgtacctgcgcgacgtgcacgggctgacgccgggcgccatcggc
ctggcgacgctggcgatgggggtggcgatgatcgccggcacctttgcctacgggccgctc
gaccgctggttcggctcgcgcaaatgggtggtcctgccgggcaatgccttggtggtgatg
ggctgcaccgcgctctggctctggccggccccaggcgtggtcaccgttctcgcgctgttc
tgcatcgtggggttcttcggcatgacctttccgctgatcctcgcccatggccgcagctat
gcgccggatcacctgatcgggcgcggcgtgacgctgatgaaccttttcggcattgccggc
gtcggcatctttcaggtcgtcaccggtcgcgtgcaggagggggccgccgcccagggcccg
atcgaggccagctatgcgccggtctttgccatctttgcgctcgtcaccctggccgggatg
atcccctatctgttcagccgcgaccggctcgactga

DBGET integrated database retrieval system