KEGG   Marinovum algicola: MALG_05026Help
Entry
MALG_05026        CDS       T03981                                 

Definition
(GenBank) DMSP demethylase (DmdA)
  KO
K17486  dimethylsulfoniopropionate demethylase [EC:2.1.1.269]
Organism
malg  Marinovum algicola
Pathway
malg00920  Sulfur metabolism
malg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malg00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MALG_05026
Enzymes [BR:malg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.269  dimethylsulfoniopropionate demethylase
     MALG_05026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C UPF0731
Motif
Other DBs
NCBI-ProteinID: AKP00154
UniProt: A0A0H4LIA7
LinkDB All DBs
Position
pMaD9:complement(74489..75595)
Genome map
AA seq 368 aa AA seqDB search
MALISPSRRLRRTPFSEGVEAAGVKAYTVYNHMLLPTVFRSMQEDYRHLKEAVQVWDVAC
ERQVELRGPDASRLMQLLTPRDLRSMLPGQCYYVPIVDETGGMLNDPVAVKLAEDRWWIS
IADSDLLYWVKGLAYGYRLDVLVDEPDVSPLAVQGPKSDDLMAAVFGDTVRDIRFFRYKV
LDFQGRDLVVARSGYSKQGGFEIYVEGSDIGMPLWHALMEAGRSLDVHAGCPNGIERVEG
GLLSYGNDMTDDNTPHECGLGKFCNTQTAIGCIGRDALLRVAVEGPVKQIRPIAMGGDPL
PGGCDRFWPIRAGDKIVGRVSSAAWSPDFDTNVAIGMIRMTHWDPGTEVTVEAPDGTRPA
TVKDNFWI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgatttccccttcccgtcgtcttcgccgcacgccgttttccgaaggcgtcgag
gccgccggcgtcaaggcttatacggtctacaaccacatgctgctgccgaccgtcttccgc
tcgatgcaggaggattaccggcatctgaaagaggcggtgcaggtctgggacgtggcctgt
gaacggcaggtcgagctgcgcggccccgacgccagccggctgatgcaattgctcaccccg
cgcgacctgcgctcgatgctgccggggcaatgctactacgtgcccatcgtcgacgagacc
ggcggcatgctgaacgacccggtggcggtgaaactggccgaggaccgctggtggatttcg
attgccgacagcgatctgctctactgggtcaaaggcctggcctatggctaccggctcgat
gttctggtggatgagcccgatgtctcgccgctggcggtgcaggggccgaagtcggatgat
ctgatggcggcggtgttcggcgacaccgtgcgcgacatccgctttttccgctacaaggtg
cttgatttccagggccgcgatctggtggtcgcgcgctcgggctattccaagcagggcggg
ttcgagatctacgtcgaaggctccgacatcggcatgccgctatggcatgcgctgatggag
gccggcaggtcgctggatgtgcacgccggctgccccaacgggatcgagcgtgtcgagggc
gggctgctgtcttacggcaatgacatgaccgacgacaacacgccgcatgaatgcgggttg
ggcaagttctgcaacacccagacggcgatcggctgtatcggccgtgacgcgctgcttcgg
gtggcggtggaagggccggtcaagcagatccggccgatcgccatgggtggcgatccgctg
cccggcggctgtgacaggttctggccgatccgggcgggagacaagatcgtgggccgcgtg
tcctcggctgcctggtcaccggatttcgacaccaacgtggccatcggcatgatccgcatg
acccattgggaccccggcaccgaagtgacggtcgaggccccggacggtacgcgcccggcg
accgtcaaagacaatttctggatttaa

DBGET integrated database retrieval system