KEGG   Massilia albidiflava: EYF70_05900Help
Entry
EYF70_05900       CDS       T05903                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mali  Massilia albidiflava
Pathway
mali00020  Citrate cycle (TCA cycle)
mali00190  Oxidative phosphorylation
mali00650  Butanoate metabolism
mali01100  Metabolic pathways
mali01110  Biosynthesis of secondary metabolites
mali01120  Microbial metabolism in diverse environments
mali01130  Biosynthesis of antibiotics
mali01200  Carbon metabolism
Module
mali_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mali_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mali_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EYF70_05900
   00650 Butanoate metabolism
    EYF70_05900
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EYF70_05900
Enzymes [BR:mali01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EYF70_05900
    1.3.5.4  fumarate reductase (quinol)
     EYF70_05900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 FAD_binding_3 HI0933_like GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: QBI00436
UniProt: A0A411WUK7
LinkDB All DBs
Position
1379680..1381458
Genome map
AA seq 592 aa AA seqDB search
MAAIKSSIPVRRFDAVIVGAGGSGMRASLQLAEAGLNVAVLSKVFPTRSHTVAAQGGIGA
SLGNMAEDNWFWHMFDTVKGGDYLGDQDAIEFMCREAPKVVYELEHFGMPFDRNPDGTIY
QRPFGGHTANFGEKAVQRACAAADRTGHALLHTLYQRNVRARTHFFVEWMALDLIRDSEG
DVIGVVALEMETGDVMILQAKTTIFATGGAGRIFAASTNAFINTGDGMGMAARAGLPLQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILINSQGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLRHIGKETIEKRLPSILEIGHKFANVDATKEPIPVVPTIHYQ
MGGIPTNIHGQVVAPSADGGQKIVNGLYAIGECACVSVHGANRLGTNSLLDLVVFGRAAG
NHVVASNLKQKEHKDLPKDASDFAMDRLNRLETSTGSEKVQGVANDIRATMQKYCGVFRT
DDLLKAGFDEIMKLDERRKHVSFKDKSKVFNTARVEALELDNLIETAKATITSAVARKES
RGAHAHSDFPNRDDDNWMKHTLWFSEGNRLEYKPVVTKPLTVETFKPKARTF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcaatcaaatcctccatccccgtacgccgcttcgacgcggtgatcgttggcgcc
ggcggttccggcatgcgcgcctccctgcaactggctgaagcgggcctgaacgtggccgtg
ctgtcgaaagtgttcccgacccgttcgcacaccgtcgcggcacagggcggcatcggcgct
tcgctgggcaacatggccgaagacaactggttctggcacatgttcgataccgtcaagggc
ggcgactacctgggcgaccaggatgcgatcgaattcatgtgccgcgaggcgccgaaggtc
gtgtacgagctggaacacttcggcatgccgttcgaccgcaatcccgacggcacgatctac
cagcgcccgttcggcggccataccgccaacttcggcgagaaggccgtgcagcgcgcctgc
gccgcggccgaccgtaccggccacgcgctgctccacacgctgtaccagcgtaacgtccgt
gcccgcacccacttcttcgtcgaatggatggcgctggacctgatccgcgacagcgaaggc
gacgtgatcggcgtggtcgcgctggaaatggaaaccggcgacgtgatgatcctgcaggcg
aagacgacgatcttcgccaccggcggtgccggccggatcttcgccgcatcgaccaacgcg
ttcatcaacaccggcgacggcatgggcatggcggcacgcgccggcctgccgctgcaggac
atggaattctggcagttccacccgaccggcgtggccggcgcgggcgtcctgatcaccgaa
ggcgtgcgcggcgaaggcggcatcctgatcaactcgcagggcgagcgtttcatggagcgc
tatgcgccgaccctgaaggacctggcgccgcgcgacttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggccgcggcgtgggcccgaacaaggaccacgtgctgctcgacctgcgc
cacatcggcaaggaaaccatcgagaagcgcttgccgtcgatcctggaaatcggccacaag
ttcgccaacgtggacgcgaccaaggaaccgatcccggtcgtgccgacgatccactaccag
atgggcggcattccgaccaacatccacggccaggtagtggcaccgtcggccgatggcggc
cagaagatcgtcaacggcctgtacgcgatcggcgaatgcgcctgcgtgtccgtgcacggc
gcgaaccgcctgggcaccaactcgctgctcgacctggtggtgttcggccgcgcggccggc
aaccatgtggtggcgtcgaacctgaagcagaaggaacacaaggacctgccgaaggatgca
tcggacttcgcgatggaccgcctgaaccgcctggaaacctccaccggttccgagaaggtg
cagggcgtggccaacgatatccgcgccacgatgcagaagtactgcggcgtgttccgtacc
gacgacctgctcaaggccggcttcgacgagatcatgaagctcgacgagcgccgcaagcac
gtgtcgttcaaggacaagtcgaaggtgttcaacaccgcccgcgtggaagcgctggaactg
gacaacctgatcgaaacggccaaggcgaccatcacctcggcggtggcccgcaaggaatcg
cgcggcgcgcacgcgcacagcgacttcccgaaccgcgacgacgacaactggatgaagcac
acgctgtggttctccgaaggcaaccgcctggagtacaagccggtcgtcaccaagccgctg
acggtggaaaccttcaagcccaaagcacgcactttctaa

DBGET integrated database retrieval system