KEGG   Massilia albidiflava: EYF70_05905Help
Entry
EYF70_05905       CDS       T05903                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mali  Massilia albidiflava
Pathway
mali00020  Citrate cycle (TCA cycle)
mali00190  Oxidative phosphorylation
mali00650  Butanoate metabolism
mali01100  Metabolic pathways
mali01110  Biosynthesis of secondary metabolites
mali01120  Microbial metabolism in diverse environments
mali01130  Biosynthesis of antibiotics
mali01200  Carbon metabolism
Module
mali_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mali_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mali_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EYF70_05905
   00650 Butanoate metabolism
    EYF70_05905
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EYF70_05905
Enzymes [BR:mali01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EYF70_05905
    1.3.5.4  fumarate reductase (quinol)
     EYF70_05905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_18 Mei4 Fer4_7 Fer2 Fer4
Motif
Other DBs
NCBI-ProteinID: QBI00437
UniProt: A0A411WVC8
LinkDB All DBs
Position
1381471..1382181
Genome map
AA seq 236 aa AA seqDB search
MARTLKFKIYRYDPDKDEKPYMQDLTVELKDTDKMLLDALQRIKSDVDDSLALRRSCREG
VCGSDAMNVNGKNRLACTTNLNELSEPIILRPLPGLPVIRDLIVDMTQFFKQYDSIKPFL
INDSIPPEKERLQTPAEREELDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLQAYRFI
ADSRDEATAQRLDNLEDPYRLFRCHSIMNCVDVCPKGLNPNRAIGKIKELMVRRAI
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaccctcaaattcaagatctaccgctacgatccggacaaggacgagaagcct
tacatgcaggacctgacggtcgagctgaaggacaccgacaagatgctgctggacgcgctg
cagcgcatcaagtccgacgtggacgattcgctggccctgcgccgctcgtgccgcgaaggc
gtgtgcggttcggacgcgatgaacgtcaacggcaagaaccgcctggcctgcacgaccaac
ctgaacgaactgtccgaaccgatcatcctgcgcccgctgccgggcctgccggtgatccgc
gacctgatcgtggacatgacgcagttcttcaagcagtacgactcgatcaagccattcctg
atcaacgactcgatcccgccggagaaggaacgccttcagaccccggccgagcgcgaagag
ctcgacggcctgtacgaatgcatcctgtgcgcgtgctgctcgacgtcgtgcccgtcgttc
tggtggaacccggacaagttcgtcggcccggccggcctgctgcaggcttaccgcttcatc
gccgactcgcgcgacgaagccaccgcccagcgcctggacaacctggaagacccgtaccgc
ctgttccgctgccactcgatcatgaattgcgtggacgtctgtccgaagggcctgaacccg
aaccgggcgatcggcaagatcaaggaactgatggtccgccgggccatttga

DBGET integrated database retrieval system