KEGG   Massilia albidiflava: EYF70_17890Help
Entry
EYF70_17890       CDS       T05903                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mali  Massilia albidiflava
Pathway
mali00061  Fatty acid biosynthesis
mali00780  Biotin metabolism
mali01100  Metabolic pathways
mali01130  Biosynthesis of antibiotics
mali01212  Fatty acid metabolism
Module
mali_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mali00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EYF70_17890 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EYF70_17890 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    EYF70_17890 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mali01004]
    EYF70_17890 (fabI)
Enzymes [BR:mali01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     EYF70_17890 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     EYF70_17890 (fabI)
Lipid biosynthesis proteins [BR:mali01004]
 Fatty acid synthase
  Component type
   EYF70_17890 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: QBI02502
UniProt: A0A411X0X9
LinkDB All DBs
Position
4345712..4346503
Genome map
AA seq 263 aa AA seqDB search
MAFLQGKKILITGLLSNRSIAYGIAQACHREGAELAFTYVGERFKDRITDFAAEFGSKLV
FDCDVASDEQIEALFRDLGQSWESLDGFVHAIGFAPREAIAGEFLDGFSRENFRIAHDIS
AYSFPAMVKAALPLLKEGSSVLTLSYLGAMRAIPYYNTMGLAKASLEASVRYLAENLGQK
GIRSNGISAGPIKTLAASGIKDFSKLLGFAASHAPLRRNVTIEEVGNTAAFLLSDLSSGI
TGDIVYVDGGFSHVMGLNASDYQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttcttgcaaggcaaaaaaatcctcatcaccggcttgctgtccaaccgctcgatc
gcctacggcatcgcgcaggcctgccaccgcgaaggcgccgagctggccttcacctatgtc
ggcgaacgcttcaaggaccgcatcaccgacttcgccgccgagttcggcagcaaactggtg
ttcgattgcgacgtcgccagcgatgagcagatcgaggcattgttccgcgacctgggccag
agctgggaaagcctggatggcttcgtgcacgcgatcggcttcgcgccgcgcgaggcgatc
gccggcgaattcctcgacggcttttcgcgcgagaacttccgcattgcccatgacatctcc
gcctacagcttcccggccatggtgaaagccgccctgccgctgctgaaggaaggctcgtcg
gtgctgacgctgtcctacctgggcgccatgcgcgcgatcccgtactacaacacgatgggc
ctggcgaaggcatcgctggaagcctcggtgcgctacctggccgagaacctgggccagaag
ggcatccgctcgaacggcatctcggccggcccgatcaagacgctggccgcgtccggcatc
aaggatttctcgaagctgctgggctttgccgccagccacgccccgctgcgccgcaacgtg
acgatcgaggaagtgggcaacacggccgccttcctgctgtcggacctgtcgtccggcatc
accggcgacatcgtctatgtcgacggcggcttctcgcacgtgatgggcctgaacgccagc
gattaccagtaa

DBGET integrated database retrieval system