KEGG   Massilia albidiflava: EYF70_22175Help
Entry
EYF70_22175       CDS       T05903                                 

Definition
(GenBank) putative 2-aminoethylphosphonate ABC transporter substrate-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
mali  Massilia albidiflava
Pathway
mali02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mali00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EYF70_22175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mali02000]
    EYF70_22175
Transporters [BR:mali02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    EYF70_22175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11 SBP_bac_8 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: QBI03231
UniProt: A0A411X2K6
LinkDB All DBs
Position
complement(5334781..5335800)
Genome map
AA seq 339 aa AA seqDB search
MPVPRIRSALAALLSIACLQSHAATTLTVYTALEADQLKAYQAAFEAGNPDIKLKWVRDS
TGIITARLLAEKAAPQADAVLGVAATSLLLLDREGMLQPYAPKGVDKLSPRYVDTARPPA
WVGMDVWGAAICFNTVEAARLGLKKPESWKDLLKPEYKGRIAMPHPASSGTGYFDVTAWL
ALFGEKEGWAYMDGLHENIAQYTHSGSKPCKQAAAGEFPIGIAFEYRAAKLKEGGAPLDV
VLPKEGLGWDVEGTAILKASKNQAAARRLADWAASRGANELYAKNFAIVAYPGVAKPHPA
IPANYETLLVRQDLRWSSRERDRILAEWTRRYDGKAEPK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcccccgtatccgtagcgcgcttgccgccttgctgtcgatcgcctgcctgcag
tcccacgccgccaccacgctgactgtctacaccgcgctggaagccgaccagctgaaggcc
taccaggcggcgttcgaagccgggaaccccgacatcaagctgaaatgggtgcgcgattcg
accggcatcatcaccgcccgcctgctggccgagaaggccgcgccgcaggccgacgcggtg
ctgggcgtggccgccacctcgctgctgctgctggacagggaaggcatgctgcagccctat
gcgccgaagggtgtcgacaagctgtcgccgcgctacgtcgacactgcacggccgccggcc
tgggtggggatggacgtgtggggcgcggcgatctgcttcaacacggtggaagcggccagg
ctgggcctgaagaagccggaatcctggaaggacctgctcaagcccgaatacaagggccgg
atcgcgatgccgcatcccgcctccagcggcaccggctatttcgacgtcacggcctggctg
gcgctgttcggcgagaaggagggctgggcatacatggacgggctgcacgagaacatcgcc
cagtacacgcattccggctcgaagccctgcaagcaggcggcggccggcgaattcccgatc
gggatcgccttcgaataccgcgctgccaagctgaaggaaggcggcgcgccgctcgacgtg
gtgctgccgaaggaaggcctgggctgggacgtggaaggtaccgccatcctcaaggccagc
aagaaccaggcggccgcgcgcaggctggccgactgggcggcctcgcgcggcgccaacgag
ctgtatgcgaagaacttcgccatcgtcgcctatccgggcgtggccaagccgcatccggcg
attccggccaattacgaaacgctgctggtcaggcaggacctgcgctggtcgtcgcgcgaa
cgcgaccgcatcctggccgagtggacccggcgctacgacggcaaggccgaacccaagtaa

DBGET integrated database retrieval system