KEGG   Massilia albidiflava: EYF70_23735Help
Entry
EYF70_23735       CDS       T05903                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
mali  Massilia albidiflava
Pathway
mali00550  Peptidoglycan biosynthesis
mali01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mali00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EYF70_23735
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EYF70_23735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mali01011]
    EYF70_23735
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mali03036]
    EYF70_23735
Enzymes [BR:mali01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EYF70_23735
Peptidoglycan biosynthesis and degradation proteins [BR:mali01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   EYF70_23735
Chromosome and associated proteins [BR:mali03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    EYF70_23735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: QBI03499
UniProt: A0A411X3C3
LinkDB All DBs
Position
complement(5731532..5733310)
Genome map
AA seq 592 aa AA seqDB search
MSRPNAASSRVAASKGVSFSKSPVLAVRLPTWRSRVVLFVLFAAFAALAVRALWLQGLST
QFLQKQGEIRYARTIELPATRGKIMDRNGQVLASSVPVKAIWAIPDDVLLAPPEKIRALA
SLLDMSEAELRKKLDSDRNFVYLKRQVEQDVADRIAKLKIDGIDTRKEYKRFYPQGEVMT
HVVGFTNVEDVGQESMELAHQKTLVGQPGTRRVIKDRLGHIVEDIGAKHEPHDGKDLVLS
VDSKIQYIAFTQLKAAVEKFAAKAGAAVVLDVHTGEVLALANYPSYDPNDRRKLTGAQLR
NRVMTDSFEPGSTLKAITVALALDKGVVTPYTSIDTGNGRLTIKDRTISDTKPHHVISVQ
QVMEMSSNIGTSKIALSMPPQDMWEMFTKVGFGQQPKWGFPGAVAGRVRPYKNWRPIEQA
TMSYGNGISVSLIQLARSYLMFARDGDLIPLTFQKSHDLPQGQQIIKPQTARQMREMLEM
VVTGKDGTAKQAQIPGYRVGGKTGTAYKVENGRYPIPRKYIGSFVGIVPLSAPRFVIAVM
IDEPTQGGRFGGQVAAPTFAKVAENALRAMNVPPDSTVTEIVAPASNEGEAM
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcccaacgccgcaagctcccgcgtggccgcctcgaaaggcgtgtcgttctcc
aagagccccgtgctggcggtgcgcctgcccacctggcgctcgcgcgtggtgctgttcgtg
ctgttcgccgcgttcgccgcgctggcggtgcgcgcgctgtggctgcagggcctgtccacc
cagttcctgcagaagcagggcgagatccgctacgcgcgcacgatcgaactgccggccacg
cgcggcaagatcatggaccgcaatggccaggtgctggcatcgtcggtgcccgtcaaggcc
atctgggcaatcccggacgacgtgctgctggcgccgccggaaaagatccgcgcgctggcc
agcctgctcgacatgagcgaggccgagttgcgcaagaagctcgattcggaccgcaacttt
gtttacctgaagcggcaggtcgagcaggacgtggccgaccggatcgccaagctgaagatc
gacggcatcgacacgcgcaaggaatacaagcgcttctacccgcaaggtgaagtgatgacc
cacgtggtgggcttcaccaacgtggaagacgtgggccaggaatcgatggagctggcgcac
cagaaaacgctggtgggccagcccggcacgcgccgcgtgatcaaggaccgcctgggccac
atcgtcgaggatatcggcgccaagcacgaaccgcacgacggcaaggacctggtgctgtcg
gtcgattcgaagatccagtacatcgccttcacgcagctgaaggcggctgtcgagaaattc
gccgccaaggccggcgctgccgtggtgctggacgtgcacaccggcgaagtgctggcgctg
gcgaactatcccagctacgacccgaacgaccgccgcaagctgaccggcgcgcagttgcgc
aaccgcgtgatgacggactcgttcgaaccgggttccacgctgaaggcgatcaccgtggcg
ctggcgctggacaagggcgtggtcacgccgtacaccagcatcgacaccggcaacggccgc
ctcaccatcaaggaccgcaccatcagcgataccaagccgcaccacgtgatcagcgtgcag
caggtgatggagatgtcgtccaacatcggtacctcgaagatcgcgctgtcgatgccaccg
caggatatgtgggaaatgttcaccaaggtcggcttcggccagcagccgaagtggggtttc
cccggcgccgttgccggccgcgtgcgtccctacaagaactggcggccgatcgagcaggcc
acgatgagctacgggaacggcatctcggtgtcgctgatccagctggcccgctcgtacctg
atgttcgcccgcgatggcgacctgattccgctcaccttccagaaaagccacgacctgccg
cagggccagcagatcatcaagccgcagacggcgcgccagatgcgcgagatgctcgagatg
gtcgtcaccggcaaggacggcacggccaagcaggcccagatccccggctaccgcgtgggc
ggcaagacaggcaccgcctacaaggtggaaaacggccgctacccgattccgcgcaagtac
atcggctccttcgtgggcatcgtgccgctgtcggcgccgcgcttcgtgatcgccgtgatg
atcgacgagccgacccagggcggccgtttcggcggccaggtggcggcgccgacgtttgcc
aaggtcgcggaaaacgcgctgcgcgccatgaacgtgcctcccgattccaccgtgacggaa
atcgtggctccggcgagcaacgaaggggaggccatgtaa

DBGET integrated database retrieval system