KEGG   Massilia albidiflava: EYF70_30125Help
Entry
EYF70_30125       CDS       T05903                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mali  Massilia albidiflava
Brite
KEGG Orthology (KO) [BR:mali00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EYF70_30125 (ahpF)
Enzymes [BR:mali01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EYF70_30125 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored FAD_binding_3 Glutaredoxin Thi4 NAD_binding_8 K_oxygenase FMO-like Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: QBI04609
UniProt: A0A411X6J8
LinkDB All DBs
Position
7232951..7234543
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKAYLEKVVQPIEIVASLDDSAKAREMKELLADIDGLSDKITLVEDNAANV
RKPSFSINRAGTDIGVRFAGIPMGHEFTSLVLALLQVGGHTIKLDEAVIEQIRNLEGDFE
FETFISLSCHNCPEVVQALNAMSVINPRIKVTTIDGGVFQKEVEERQIMAVPMMFLNGQH
FGQGRTNVEEILAKLDTNAGARQAAELNKKDVFDVLVVGGGPAGAASAIYAARKGIQTGV
LAERFGGQVLDTLSIENFISIKETDGPKFAVALEQHVKEYEVDIMNTQRAVKLVPGRVTE
VHTATGAVLKAKTVILSTGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVSVIGGG
NSGVEAAIDLAGIVQHVTLIEFGNELRADAVLQRKLRSLPNVKVILSAQTTEIHGDGKKV
NGLSYKDRNTNELHRVDLEGVFVQIGLVPNTEWLKGTVALSKHGEIEIDAKGQTSVPGVF
AAGDVTTVPYKQIVIAVGAGATAALSAFDHLIRSGDDEVEAEQAAIAAVA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgcaaatctcaaaacccaactgaaagcctatctggaaaaagtggtgcagccg
attgagatcgttgcatcgctggatgattccgcgaaggcgcgggaaatgaaggaactgctc
gccgatatcgatggcttgagcgacaagattaccctggtcgaggacaacgccgccaacgtg
cgcaagccgtcgttctcgatcaaccgtgccggcaccgacattggcgtgcgttttgccggc
atcccgatgggccatgaattcacctcgctggtgctggccctgctgcaggtgggcggccac
acgatcaagctcgacgaagccgtgatcgaacagatccgcaacctggaaggcgatttcgaa
ttcgagaccttcatctcgctgtcgtgccataactgcccggaagtggtgcaggcgctgaac
gcgatgtcggtcatcaacccgcgcatcaaggtcaccacgatcgatggcggcgtgttccag
aaagaagtcgaagagcgccagatcatggcggtaccgatgatgttcctgaacggccagcac
ttcggccagggccgcacgaacgtggaagaaatcctcgccaagctggacaccaatgccggt
gcccgccaggcggctgaactgaacaagaaagacgtgttcgacgtgctggtcgtcggcggc
ggccctgccggtgcggcgtcggcgatctacgcggcccgtaaaggcatccagaccggcgtg
ctggcggaacgcttcggcggccaggtgctcgatacgctgtcgatcgagaacttcatctcg
atcaaggaaaccgatggcccgaaattcgccgtggcgctggagcagcacgtcaaggaatac
gaagtcgacatcatgaatacccagcgcgccgtgaagctggtgccgggcagggtcaccgaa
gtgcacaccgccaccggcgcggtgctgaaggcgaagaccgtgatcctgtccaccggtgca
cggtggcgcgagatcaacgtgccgggcgagaaggagtaccgtaaccacggcgtggcgtac
tgcccgcactgcgatggcccgctgttcaagggcaagcgcgtgtcggtgatcggtggcggc
aactccggcgtggaagcggcgatcgacctggccggcatcgtgcagcatgtcacgctgatc
gagttcggcaacgaactgcgtgccgatgcggtcctgcagcgcaagctgcgctcgctgccg
aacgtgaaggtgatcctgtcggcgcagacgaccgagatccacggcgatggcaagaaggta
aacggcctgtcgtacaaggaccgcaacaccaacgagctgcaccgcgtggacctggaaggc
gtgttcgtgcagatcggcctggtgccgaacacggagtggctgaagggcaccgtggcgctg
tcgaagcatggcgagatcgagatcgatgccaagggccagacctcggtaccgggcgtgttc
gccgccggcgacgtcaccaccgtgccgtacaagcagatcgtgatcgccgtgggtgccggt
gcaacggccgcgctgtccgccttcgaccacctgatccgctcgggtgacgatgaagtggaa
gccgagcaggccgccatcgccgccgtcgcgtaa

DBGET integrated database retrieval system