KEGG   Microcella alkaliphila: MalAC0309_0875Help
Entry
MalAC0309_0875    CDS       T05359                                 

Definition
(GenBank) uncharacterized protein
Organism
malk  Microcella alkaliphila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tmemb_14
Motif
Other DBs
NCBI-ProteinID: BAU31741
UniProt: A0A0U5BTJ0
LinkDB All DBs
Position
886689..887885
Genome map
AA seq 398 aa AA seqDB search
MSDRSHVSPWSTDPISWVTTAAIPVTATVLAVVYSVIEVIAVPPRGGALQWLGILLLAAS
GAIVHVRTRPPRGVLGAPEIMTIFGLLSAATLCSALDHQGVAFSITFWWAPFGVSLVLVA
MAPYVRASSIAALAVALVGVVSLIAVVLIIPDDPSWPPVTTALIVVTPVVAGGTVSAVLS
GSIVRRLMRWSERPLPGAPVIGPAGIDDRALVRAVDDEISEQLAAAVAFLRTVARRGEVT
DRDARQARSLSLELRARLIADASATWLERVVRGHPVDLDDPERLADRLSVSQRTALRAMI
DALLAHPESGFVSASIALRGSASGDVAVAMRINTTLPEGRRISFLAPYYVSLSSAVRDIQ
WRDGATLKVEFEAPAETTAGRAPLVQRTPRSETAGERD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgttcgcacgtgtccccctggtcgaccgacccgatcagctgggtgacgacc
gccgcgattccggtgacggcaacggtcctcgccgtcgtctacagcgtgatcgaggtgatc
gccgttccgccgcgcggcggtgccctgcagtggctcggcattctgctgctcgccgcatcg
ggtgcgatcgtgcatgtgcgtacgcgtccgccgcgcggagtgctgggcgcacccgagatc
atgaccattttcggcttgctgagcgccgccacgctgtgctcggctctcgaccatcagggc
gtcgccttttcgatcacattttggtgggcacccttcggggtgtctctcgtcctcgtcgcg
atggccccctacgtgcgtgcatcgagtattgccgcgctcgctgtcgcgctggtgggggtt
gtctcgctcatcgccgtcgtgctcatcattcccgacgatccgagctggccgccggtcacg
accgcgctcatcgtggtcaccccggtcgtggccgggggtaccgtgagcgcggtgctctcc
ggcagcatcgtgcgccggctcatgcgctggagtgagcgacccctccccggggcccccgtg
atcggaccggcgggcatcgatgaccgggcgctggtgcgggccgtcgacgacgaaatttcg
gagcagttggcagccgccgtcgcgtttctgcgcaccgttgcccgacggggcgaggtcacc
gacagggatgcgcgccaggcccgttcgttgtcgctcgaattgcgggcgcggctcatcgcc
gacgcgtcggccacctggctcgagcgcgtcgtgcgcggtcaccccgtcgacctcgacgac
cccgagcgtctcgccgaccggttgagcgtctcgcagcgcaccgccctccgcgcgatgatc
gatgcgctgctcgcgcatcccgaatcggggttcgtgtcggcgagtattgccctgcggggc
tccgcatcgggtgatgtcgccgtcgcgatgcgcatcaacacgaccctgcccgaggggcgg
cgcatcagcttcctcgcgccctactacgtctcgttgtcgtctgccgtgcgcgacatccag
tggcgcgacggcgcgactctcaaggtggagttcgaggcgcccgccgaaacgacagcgggg
cgtgcgccgctcgtgcaacgcacgccccggagcgagacggcaggggagcgggactag

DBGET integrated database retrieval system