KEGG   Microcella alkaliphila: MalAC0309_0991Help
Entry
MalAC0309_0991    CDS       T05359                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
malk  Microcella alkaliphila
Pathway
malk00250  Alanine, aspartate and glutamate metabolism
malk00280  Valine, leucine and isoleucine degradation
malk00310  Lysine degradation
malk00410  beta-Alanine metabolism
malk00640  Propanoate metabolism
malk00650  Butanoate metabolism
malk01100  Metabolic pathways
malk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:malk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MalAC0309_0991 (gabT)
   00650 Butanoate metabolism
    MalAC0309_0991 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MalAC0309_0991 (gabT)
   00280 Valine, leucine and isoleucine degradation
    MalAC0309_0991 (gabT)
   00310 Lysine degradation
    MalAC0309_0991 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MalAC0309_0991 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:malk01007]
    MalAC0309_0991 (gabT)
Enzymes [BR:malk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MalAC0309_0991 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MalAC0309_0991 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     MalAC0309_0991 (gabT)
Amino acid related enzymes [BR:malk01007]
 Aminotransferase (transaminase)
  Class III
   MalAC0309_0991 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAU31854
UniProt: A0A0U5BF73
LinkDB All DBs
Position
999602..1000954
Genome map
AA seq 450 aa AA seqDB search
MSMTTAGPTVTGGPSLPQERRLVTAIPGPKSQQLIERKNAAVSASVGTMMPVYAVAGGGG
VIVDVDGNSLIDMGSGIAVTNVGNADPHVAQAVIEQVQRFTHTCFMVTPYDGYVELAEKL
NEITPGDHAKRTALFNSGAEAVENAIKIARYYTGKSAVVAFDHGYHGRTNLTMALTAKAM
PYKSGFGPFAPDVYRAPMSYPFRDGLSGEEAAARAIHTMEKQIGADRLAAIIIEPIQGEG
GFIVPAKGFLPALQKWANENNVVFIADEVQTGFARTGQMFASEDEGIVPDMMTLAKGIAG
GLPLAAVVGRQDIMDAPHVGGLGGTYGGNPIATAAALGALKAYEEGNLLERAHEIGAILQ
AELTAMKSRDPRVGDVRGRGAMMAIELIDADGKPDAALTQRVAKACHAAGVIVLTCGTDG
NVFRLLPPLSITDELLREGLTVIADALAAN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaccactgcaggccccaccgtcaccggcggcccgtcgcttccgcaggagcgt
cgcctcgtcacggcgattcccggcccgaagtcgcagcaactcatcgagcggaagaacgcc
gccgtgtccgcctcggtcggcacgatgatgcccgtttacgcggtcgccggcggcggtggc
gtcatcgtcgacgtcgacggcaacagcctcatcgacatgggcagcggcatcgccgtcacc
aacgtcggcaacgccgacccgcacgtcgcccaggccgtcatcgagcaggtgcagcgcttc
acccacacctgcttcatggtgaccccctacgacggctacgtcgagctcgccgaaaagctc
aacgaaatcacccccggcgaccacgccaagcgcacggctctgttcaactcgggcgcggag
gccgtcgagaacgccatcaagatcgcccgctactacacgggcaagtcggccgtcgtcgcg
ttcgaccacggctaccacggccgcaccaacctcaccatggcgctcaccgcgaaggccatg
ccctacaagagcggcttcggcccgttcgcgcccgacgtgtaccgcgcgccgatgtcatac
cccttccgcgacggactgtcgggtgaagaagccgcggcgcgcgcgatccacacgatggag
aagcagatcggcgccgaccgtctcgccgcgatcatcatcgagcccattcagggtgagggc
ggtttcatcgttcccgccaagggcttcctccccgccctgcagaaatgggcgaacgagaac
aacgtcgtcttcatcgccgacgaggtgcagaccggcttcgcccgcaccggccagatgttc
gcgtcagaggacgagggcatcgtgcccgacatgatgaccctcgccaagggcatcgccggt
ggcctgccgctcgctgcggtcgtcggccgccaggacatcatggacgccccgcacgtcggc
ggcctcggcggcacctacggcggcaaccccatcgccaccgccgccgcgctcggcgcgctc
aaggcgtacgaggagggcaacctgctcgagcgcgcgcacgagatcggcgccattctgcag
gccgagctcaccgccatgaagtcgcgcgacccccgcgtcggcgacgtgcgcggacgcggc
gccatgatggcgatcgagctcatcgacgccgacggcaagccggacgccgccctcacgcag
cgcgtcgcgaaggcctgccacgcggccggcgtcatcgtcctcacctgcggcaccgacggc
aatgtgttccgcctcctgccgccgctgtccatcaccgacgagctgctgcgcgagggcctt
acggtcatcgccgacgcgctcgccgcgaactga

DBGET integrated database retrieval system