KEGG   Microcella alkaliphila: MalAC0309_1650Help
Entry
MalAC0309_1650    CDS       T05359                                 

Definition
(GenBank) uncharacterized protein
Organism
malk  Microcella alkaliphila
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAU32501
UniProt: A0A0U5BLU4
LinkDB All DBs
Position
1632643..1633182
Genome map
AA seq 179 aa AA seqDB search
MGLFSKKQTVVSVAFRELSEPPPKNELRSTYRYVSTLTPAPVVGDRLMVRGSDGKLAPVI
VVAVEVTKATDGLAPVERAVTAEELDQATQKAAKDLDTWFRMARRSAGLSVSGRLPGKPP
GDLPEIPPADGEASREDADAWGRGWYRIWKLAEEHGRGAEEIAAFKSKAYRWFAVRDRS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggccttttctcgaagaagcagaccgtggtgagtgttgccttccgggaactgagcgag
ccgcctccgaagaatgagctccggtcgacctatcggtacgtgtccacgctgactccggcg
ccggtcgtcggcgaccgcttgatggtgcggggctcggacgggaagcttgcgccggtcatc
gttgtggccgtcgaggtgaccaaggcgaccgacgggctcgcgccggttgagcgtgcggtg
accgcggaggagctggatcaggcgacgcaaaaagcggcgaaggatctcgacacttggttc
cgaatggctcgtcgcagtgctgggctgagcgtcagcgggcgcctgcccggaaagccgccg
ggcgacctgccggagatcccgccggcggacggtgaggcctcccgagaggatgccgatgcg
tggggtcgtggctggtaccgaatctggaagctcgccgaggaacacggtcggggtgcggag
gagatcgctgccttcaagtcgaaggcctaccgctggttcgcggtgcgcgatcgcagctga

DBGET integrated database retrieval system