KEGG   Mesorhizobium australicum: Mesau_01088Help
Entry
Mesau_01088       CDS       T02417                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mam  Mesorhizobium australicum
Pathway
mam00020  Citrate cycle (TCA cycle)
mam00190  Oxidative phosphorylation
mam00650  Butanoate metabolism
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
mam01200  Carbon metabolism
Module
mam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mam_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesau_01088
   00650 Butanoate metabolism
    Mesau_01088
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mesau_01088
Enzymes [BR:mam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Mesau_01088
    1.3.5.4  fumarate reductase (quinol)
     Mesau_01088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 DAO Thi4 FAD_binding_3 FAD_oxidored HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGB43567
UniProt: L0KE17
LinkDB All DBs
Position
1135464..1137299
Genome map
AA seq 611 aa AA seqDB search
MAQDTKSANAAGYTFVDHKFDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRSHTVA
AQGGIAASLSNMGPDSWQWHMYDTVKGSDWLGDVDAMEYLVREAPAAVYELEHYGVPFSR
TEEGKIYQRPFGGHMMNYGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEYFAL
DLIMEPDGTCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAA
RAGFPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRD
VVSRCMTLEIREGRGVGKAKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDLTKEPIP
VLPTVHYNMGGVPTNYWGEVLNPTADNPDRVSPGLMAVGEAGCASVHGANRLGSNSLIDL
VVFGRAAAIRAGQVIDRKAAIPSPNQASVDKIMDRFDRLRHANGSTPTAVLREKMQKAMQ
EDAAVFRTQESLENGCKRISEIWTELKDVKVFDRSMIWNSDLVETLELENLMANAITTVY
GAEARKESRGAHAREDFSARDDANWRKHTLAHLSEDGAVTLTYRPVHTEPLLAEKDGGIS
LAKIAPKARVY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
ttggcccaggacacgaaatcagccaacgcggcaggctacacctttgtcgatcacaagttc
gacgtggtcgtcgtcggcgccggcggcgccgggctgcgcgccacgcttggcatggccgaa
cagggcctgcgcaccgcctgcatcaccaaggtgttcccgacccgctcgcacacggttgcc
gcgcaaggcggcatcgccgcgtcgctgtccaacatgggcccggattcctggcagtggcac
atgtacgacaccgtcaagggctcggactggctgggcgatgtcgacgccatggaatatctg
gtgcgcgaagccccggcggccgtttacgaactcgaacattacggcgtgccgttctcgcgc
accgaagagggcaagatctaccagcggccgttcggcggccacatgatgaactatggcgac
gggccgccggtgcagcgcacctgtgcggccgccgaccgcaccggccatgccatcctgcac
acgctctacggccagtcgctgaagaacaacgcgcagttcttcatcgagtatttcgcgctc
gatctgatcatggaaccggacggcacctgcaccggcgtcgtggcgtggaatctggacgac
ggcaccatccaccgcttctcggccaagatggtggtgctggcgaccggcggctatgggcgc
gcctatttttcggcgacctcggcacacacctgcaccggcgacggtggcggcatggcggcg
cgggcggggttcccgttgcaggacatggagttcgtgcagtttcacccgaccggtatctat
ggcgccggctgcctgattaccgagggcgcgcgcggcgagggcggctatctcgtcaactcc
gagggcgaacgcttcatggagcgctacgcaccgtcggccaaggacctcgcctcgcgcgat
gtcgtctcgcgctgcatgacgctggaaattcgcgaaggccgcggcgtcggcaaggccaag
gaccacatcttcctgcacctcgatcatctcgatccggcggtcttgcacgaaaggcttcca
ggcatttcggagtcggcgaaaatcttcgccggcgtcgacctgaccaaggagccaatcccg
gtgctgccgacggtgcactacaatatgggcggcgtgccgaccaattattggggcgaggtg
ctcaatccaaccgcggacaaccccgaccgggtctcgcccggcctgatggcggtcggcgag
gccggttgcgcttccgtgcacggcgccaaccggcttggctcgaactcgctgattgacctg
gtggtgttcggccgcgccgcggcgatccgcgccggccaggtcatcgaccgcaaggcggcg
atcccgtcgcccaaccaggcttcggtcgacaagatcatggatcgcttcgaccggctccgc
cacgccaacggctcgacgccgacggctgtccttcgtgaaaagatgcaaaaggcgatgcag
gaagatgccgccgtgttccgcacgcaggaatcgctcgaaaacggctgcaagcgtatttcg
gaaatctggaccgagctcaaggatgtcaaagtcttcgaccgctcgatgatctggaactcg
gacctggtcgagactctggaactggaaaacctgatggccaacgccatcaccaccgtctac
ggcgccgaggcgcgcaaggagagccgaggcgcgcatgctcgggaagatttttccgcccgc
gacgacgccaactggcgcaagcatacgctcgcccatctcagcgaggacggcgcggtgacg
ctgacctataggccggtgcacaccgagccgcttttggccgaaaaggacggcggcatcagt
ctggccaagatagcgccgaaggccagggtgtactga

DBGET integrated database retrieval system