KEGG   Mesorhizobium australicum: Mesau_01090Help
Entry
Mesau_01090       CDS       T02417                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mam  Mesorhizobium australicum
Pathway
mam00020  Citrate cycle (TCA cycle)
mam00190  Oxidative phosphorylation
mam00650  Butanoate metabolism
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
mam01200  Carbon metabolism
Module
mam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mam_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesau_01090
   00650 Butanoate metabolism
    Mesau_01090
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mesau_01090
Enzymes [BR:mam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Mesau_01090
    1.3.5.4  fumarate reductase (quinol)
     Mesau_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer2
Motif
Other DBs
NCBI-ProteinID: AGB43569
UniProt: L0KGQ8
LinkDB All DBs
Position
1137736..1138515
Genome map
AA seq 259 aa AA seqDB search
MVELTLPKNSKVQQGKTWPKPEGATNLREYRIYRWSPDDDENPRMDTYFVDMDDCGPMVL
DALLWIKNKIDPTLTLRRSCREGICGSCAMNIGGSNTLACTKGCEDISGAIKIYPLPHMP
VIKDLVPDLTNFYAQHASIEPWLKTVSPTPAKEWLQSHEDREKLDGLYECILCACCSTSC
PSYWWNGDRYLGPATLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaactcacgctcccaaagaactcgaaggtccagcagggcaagacctggccgaag
ccggagggtgccaccaatctcagggaataccgcatctatcgctggtcgccggacgacgac
gagaacccgcgcatggacacctacttcgtcgatatggacgattgcgggccgatggtgctc
gacgcgctgctgtggatcaagaacaagatcgacccgacgctgaccttgcgccgctcctgc
cgcgaaggcatttgcggttcctgcgccatgaacatcggcggctcgaacacgctcgcctgc
accaagggctgcgaagacatatcgggggcgatcaagatctatccgcttccgcatatgccc
gtgatcaaggacctggtgcccgatcttaccaatttctacgcccagcacgcctccatcgag
ccatggctgaagacggtgtcgccaacgccggccaaggaatggctgcagagccatgaggac
cgcgaaaagctcgacgggctttacgagtgcatattgtgcgcctgctgctcgacctcgtgc
ccgagctactggtggaacggcgaccgctatctcggcccggcgacgctgctgcaggcctat
cgctggctgatcgacagccgcgacgaggccaagggggaacggctcgacaatctcgaagac
ccgttccggctctatcgctgccacaccatcatgaactgcgcgcagacctgcccgaagggg
ctcaatcccgcgaaggcgatcgccgagatcaagaagatgatggtggagagaagggtttag

DBGET integrated database retrieval system