KEGG   Mesorhizobium australicum: Mesau_01130Help
Entry
Mesau_01130       CDS       T02417                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mam  Mesorhizobium australicum
Pathway
mam00500  Starch and sucrose metabolism
mam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mesau_01130
Enzymes [BR:mam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Mesau_01130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Prenyltrans
Motif
Other DBs
NCBI-ProteinID: AGB43609
UniProt: L0KGU2
LinkDB All DBs
Position
complement(1174321..1176738)
Genome map
AA seq 805 aa AA seqDB search
MAVTPIVPPGAPGIPARWTSSAKSGVGSALSPSSRVWFTTSHGILNEVYYPRVDSACTRD
LGLIVTGMDGYFSEEKRDASHGIEPFEDGVPAYRLVNTADDGAYRIEKRIVADPARPTLL
QEITFSPLKGSAADYRVYALLAPHLVNAGMGNTAWIGEYQGKPVLFASGRGTCLALASSL
PWRDCSAGYVGFSDGWQQLNSAGKLDTACRRAEDGNVALTGEIGFTAANTKTMLALGFGT
TPDEAAENAFASLKRGFEPAAKSYVEQWREWQAGLLPLDRHAVPGVNSYRVSTAVLATHR
SSAMPGAAVASLSIPWGFNKGDDDLGGYHLVWPRDLVETAGGFLAAGDAASALRILEYLR
SIQQPDGHWPQNAWLDGSAYWPGIQMDECAFPLLLVDALHRAGHLPRARLKAFLPMIERA
ASYVVRNGPVTGEDRWEEDAGYSPFTMAVEIAALLAGADLLDACGKAAEAAYLRETADCW
NDQVERWSYVSGTAICKAVGVGGYYVRIAPPDDPEAGSPKDGYVPIKNRPPGDTDRPAEE
IVSPDALALVRFGLRAADDPRIVDTVKIIDAQLRCELPQGPLWYRYNSDGYGEHEDGTPF
DGTGQGRPWPLLAGERAHYELAAGRKDKAASLLDALERSAGPGGLLPEQVWDGADIPERE
LLHGKPSGSAMPLVWAHSEHIKLLRSLRDGAVFDMPPQGVKRYIQDKTVSSFRAWRFNNK
IRALPEGKTLRVELLTAATIHWSTDNWATAHDSRTAENAFGLHLVDLPTASLPNGSTLIF
TFFWPGTGDWENVDFSVMSGAQDSQ
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgacgccgattgtgccgccgggcgcgccgggaattcccgcgcgctggacctca
agcgccaagagcggagtcggctcggcgctttcgccgtccagccgcgtctggttcaccacc
agccacggcatcctgaacgaggtgtactatccgcgcgtcgacagcgcctgcacgcgcgac
ctcggcctgatcgtcaccggcatggatggctatttctccgaggagaagcgcgatgcctcg
cacggcatagagccgttcgaggacggcgtgcccgcctacaggctggtcaatacagccgac
gacggcgcctaccggatcgagaagcgcatcgtggccgatccggcgcgaccgaccttgctg
caggaaatcaccttcagtccgctcaagggctccgcggccgactaccgcgtctacgcgctt
ctggcgccgcatctggtcaatgccggcatgggcaacaccgcctggatcggcgagtaccag
ggaaaacccgtcctgtttgcctcggggcgcggcacctgcctggcgctggcctcgtccctg
ccctggcgggattgctcggccggctatgtcggcttctccgacggctggcagcaactcaac
agcgccggcaagctcgatacggcttgccggcgtgccgaggacggcaatgtcgcgctgacc
ggcgagatcggcttcaccgccgccaacacaaaaaccatgctggcgctgggttttgggacg
acaccggacgaagccgccgaaaacgccttcgccagcctgaagcggggttttgaaccggcg
gcgaaatcctacgtcgaacaatggcgcgaatggcaggcggggctgctgccactggaccgc
cacgcggtccccggagtgaacagctaccgcgtctccaccgcggtgctggccacccaccgg
tcgtcggcaatgcccggcgcggcggtggccagcctgtcgatcccatggggattcaacaag
ggcgacgatgatctcggcggctatcatcttgtctggccacgcgacctggtcgaaacagcg
ggcggctttctcgccgccggcgatgccgcctcggcactgcggatcctggaatatctccgc
tccatccagcagccggacggccattggccgcagaacgcctggctcgacggctccgcctat
tggcccggcatccagatggacgaatgcgcctttcccttgctgctggtggatgccctgcat
cgcgctggccacttgccgcgtgccaggctgaaggccttcctgccgatgatcgagcgcgcc
gcctcctatgtcgtgcgcaatggtccggtcactggcgaggaccgctgggaagaagacgcc
ggctacagcccgttcacgatggccgtcgagatcgcggcactgcttgccggcgccgacctg
ctcgatgcctgcggcaaagcggcggaggcggcctacctgcgcgaaacagccgactgctgg
aacgaccaggtcgagcgctggagctatgtcagcggcaccgccatctgcaaggccgtcggc
gtcggcggctattacgtccgcattgcgccgccagacgaccccgaagccggctcgccgaag
gacggctatgtcccgatcaagaaccggccaccaggcgacaccgaccgaccggccgaggaa
atcgtcagccctgacgcgctggccctggtgcgctttggcctgagagccgccgacgatccg
cgcatcgtcgacaccgtcaagatcatcgacgcgcagctgcgctgcgaactgccgcaaggg
ccgctctggtaccgctataacagcgacggctatggcgagcacgaggatggcacgcccttc
gacggcaccggccagggccggccgtggcccctgctggccggcgaaagggcgcattacgag
ctggccgccgggcgcaaggacaaggcggccagcttgctcgatgcgctggagcggtcggcc
gggcctggcggcctgctgcccgaacaggtgtgggacggcgccgatattcctgaacgcgag
cttctgcatggcaagccatcggggagcgccatgccactggtctgggcgcattccgaacac
atcaagctgctgcgctcgctacgcgacggcgccgtcttcgatatgccgccgcaaggcgtg
aagcgctacatccaggacaagaccgtatcgtcgttcagggcatggcgcttcaacaacaag
atccgcgcactgcccgagggcaagacattgcgcgtcgagctgctgacggcggccaccatc
cactggagcacggacaattgggcaaccgcccacgacagccggacagcggaaaacgctttc
ggccttcatcttgtcgatctgcccacggccagcctccccaacggaagcacgctgatcttc
acttttttctggcccggaaccggcgattgggagaatgtcgacttctccgtcatgtcaggc
gcgcaggacagccagtag

DBGET integrated database retrieval system