KEGG   Mesorhizobium australicum: Mesau_02061Help
Entry
Mesau_02061       CDS       T02417                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mam  Mesorhizobium australicum
Pathway
mam00910  Nitrogen metabolism
mam02010  ABC transporters
Module
mam_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Mesau_02061
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mesau_02061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mam02000]
    Mesau_02061
Transporters [BR:mam02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Mesau_02061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Romo1 DUF389
Motif
Other DBs
NCBI-ProteinID: AGB44504
UniProt: L0KJF8
LinkDB All DBs
Position
complement(2120862..2121752)
Genome map
AA seq 296 aa AA seqDB search
MSIQAVEDTKVKAFPAKSAEVVAFTGKARRRVDPVAVAAKVASALVPPAIVIALLLVVWQ
VACSSPTASLPPPSQVWNEAYDLIAHPFFDNGPQDIGLAWRVLISLQRVAIGFGMAAVVG
VALGALVGQSIWAMRGLDPVFQILRTVPPLAWLPLSLAAFRDSNPSALFVIFITSIWPVI
INTAVGVRNIPQDYRNVARILRLNQLEFFIKIMVPAAAPYIFTGLRIGIGLSWLAIVAAE
MLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVTGFCLDRLVAAVGAFVTRGTTAK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccaagccgtcgaggacaccaaggtgaaagcattcccggccaagtcagccgag
gtggtcgccttcaccggcaaagcgcggcgccgtgtcgatccggtggcggtcgccgccaag
gtggccagcgctctcgtcccgcccgccatcgtcatcgcccttctgcttgtcgtctggcag
gtcgcctgctcgtcgccgacggcaagcctgccgccgccgagccaggtgtggaacgaggcc
tatgacctgatcgcgcatccattcttcgacaacggcccgcaggatatcggccttgcctgg
cgggtgctgatctcgctccagcgcgtcgccatcggcttcggcatggcggcggtcgtcggt
gtggcgctcggcgcgctggtcggccagtcgatctgggcgatgcgcggcctcgatccagtg
ttccagatcctgcgcaccgtgccgccgctcgcctggctgccgctgtcgctcgccgccttc
cgcgactccaacccgtcggctctgttcgtgatcttcatcacttctatctggccggtcatc
atcaacactgccgtcggcgtgcgcaacatcccgcaggactatcgcaatgtcgcccgcatc
ctgcggctgaaccagctcgagttcttcatcaagatcatggtgccggccgctgcgccttac
atcttcaccggcctgcgcatcggcatcggcctgtcctggctcgccatcgtcgcggccgaa
atgctgaccggcggcgtcggcatcggcttcttcatctgggacgcgtggaattcgtcacgg
ctgcccgacatcatcgtcgcgctcgcctatatcggcgtcaccggcttctgcctcgaccgc
ctggtcgcggcggtcggcgcctttgtcacccgcggcacgacggcaaagtga

DBGET integrated database retrieval system