KEGG   Mesorhizobium australicum: Mesau_02516Help
Entry
Mesau_02516       CDS       T02417                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mam  Mesorhizobium australicum
Pathway
mam00010  Glycolysis / Gluconeogenesis
mam00620  Pyruvate metabolism
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesau_02516
   00620 Pyruvate metabolism
    Mesau_02516
Enzymes [BR:mam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Mesau_02516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AGB44938
UniProt: L0KLG7
LinkDB All DBs
Position
complement(2578263..2579780)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRSVKAPFDKRYGNFIGGKWAEPRSGRYFENFSPVNGQLLCEVARSDAQDIEAA
LDAAHGAKDAWARTSVAERSLILNRIADRMEENLDLLACAETWDNGKPIRETTAADLPLA
IDHFRYFAGALRGQEGSLSQIDDDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAA
GNCVVLKPAEQTPAAILLWADLVGDLLPAGVLNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVVAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALVHESIYDRFMERALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYIDIGRQ
EGAEVLAGGARNVLPGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVTTFKDDDDALS
IANDTLYGLGAGIWTRDGNRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattttcacgctcggtcaaggcgcccttcgacaagcgctatggcaat
ttcatcggcggcaaatgggccgagccgcgctccggccgctatttcgagaacttctcgccg
gtaaatggccagttgctgtgtgaagtggcgcgctcggacgctcaggacatcgaggccgcc
ctcgacgcggcgcacggcgccaaggacgcctgggcacgcacgagcgtcgccgagcggtcg
cttatcctcaaccgcatcgccgaccggatggaggaaaacctcgatctcctggcgtgcgcc
gaaacctgggacaacggcaagccgatccgtgaaacgacggcggccgacctgccgcttgcg
atcgatcatttccgctattttgccggcgcgctgcgcggccaggaaggcagcctttcccag
atcgacgacgacaccgtcgcctatcatttccacgagccactcggcgtggttggccagatc
atcccctggaactttccgctgctgatggcgtgctggaagcttgctccggcgctcgcagcc
ggcaattgcgttgtgctgaagcccgccgagcagacgccggccgccatattgctctgggcg
gatctcgtcggcgacctgctgccggcgggcgtgctcaacattgtcaacggcttcggcctc
gaggccggcaagccgctcgcgtcctcgccgcgtattgccaagatcgcctttaccggcgag
accacgacgggccggcttattatgcaatatgccagccagaacctcattcccgtcacgctc
gaactgggcgggaagtcgccgaacatcttcttcaaggatgtcgtcgccgaggatgacgat
ttcttcgacaaggcgatcgaaggcttcgtcatgttcgcgctgaaccagggcgaggtctgc
acctgcccgagccgcgccctcgtccatgaatcgatctatgacaggttcatggagcgtgcc
ctcaagcgcgtcgaggcgatcgtacagggcgatccgctcgacccggcaacgatgatcggg
gcgcaggcctcgtccgagcagctggaaaagatcctgtcctacatcgacatcggccgccag
gaaggcgccgaggtgctggcaggcggcgcgcgcaatgtcctgcctggcgatctggcgggc
ggctattacgtcaagcccaccgtgttcaagggccacaacaagatgcgcatcttccaggag
gagatctttgggccggtggtctcggtgacgaccttcaaggacgacgacgacgcgctgtcg
atcgccaacgacacgctctacggcctcggcgccggcatctggactcgcgacggcaaccgg
gcctaccgcttcggccgggcgatccaggcgggccgcgtctggaccaattgctaccacgcc
tatccggcgcacgctgcgttcggtggctacaagcagtccggcatcggccgcgagacgcac
aagatgatgctcgaccactatcagcagaccaagaacatgctggtcagctacagcccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system