KEGG   Mesorhizobium australicum: Mesau_03231Help
Entry
Mesau_03231       CDS       T02417                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mam  Mesorhizobium australicum
Pathway
mam00473  D-Alanine metabolism
mam00550  Peptidoglycan biosynthesis
mam01100  Metabolic pathways
mam01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mesau_03231
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mesau_03231
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Mesau_03231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mam01011]
    Mesau_03231
Enzymes [BR:mam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Mesau_03231
Peptidoglycan biosynthesis and degradation proteins [BR:mam01011]
 Precursor biosynthesis
  Amino acid ligase
   Mesau_03231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: AGB45600
UniProt: L0KLP6
LinkDB All DBs
Position
3279624..3280703
Genome map
AA seq 359 aa AA seqDB search
MTGKIRVAILYGGRSAEHDVSRLSAANVLKAIDRTRYEVVPIAISREGRWLLQPASEAIG
EGAGAPVSQDGMEIALLPGGKGRLISASPMGTRADLAPVDVVFPVLHGPFGEDGSVQGYA
EVADVAYVGSGILASAAAMDKDVAKRLMQGAGLAVARSVTVHRNDVGSFQEIAGALGLPF
FAKPARQGSSFGVSKVNDRDGFDQAVETAFRYDGKALIEEFVEGREIECSVLQRADGSLT
VSLPGEIIPAGKHGFYTYEAKYLDADGAVVKVPADVPAAVIDRAREMAGQAFKALGCEAM
ARVDFFLRADGSLLVNEVNTLPGFTDISMYAKALAAIGIGYSEVIDILIEHALARHGAR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaaagatcagggttgcgatcctctatggcgggcgctcggccgagcatgacgtg
tcgcggctttcggccgccaatgtgctgaaggcgatcgaccggacgcgctacgaggtggtg
ccgatcgccatttccagggagggcagatggctgctgcagccggcgtccgaggccatcggc
gaaggggcgggagctccagtgtcgcaggatggcatggagatagccctgctgcccggcggc
aagggccggctgatctcagcgtcgcctatgggaacgcgggctgacctggcgccggtcgat
gtcgtcttccccgtgctgcatgggcctttcggggaggacggctcggtgcagggctatgcg
gaggttgccgacgtcgcctatgtcggcagcggcatcctcgcctcggccgccgccatggac
aaggatgtcgccaagcggctcatgcaaggagccgggcttgccgtcgcccgctcggtcacc
gtccatcgtaacgacgtcgggtccttccaggagatcgccggggcgctggggctgccattc
ttcgccaagccggcgcgccagggctcgtcgttcggagtgagcaaggtgaacgacagggat
ggtttcgatcaggccgtcgaaacggctttccgctatgacggcaaggcgttgatcgaggaa
ttcgtcgaaggccgcgagatcgagtgctcggtgctgcaacgggccgacggctcgctcacg
gtgtcgctgcccggcgagatcatcccggccggcaagcacggcttctacacctatgaggcc
aaatatctcgacgccgacggcgcggtggtcaaagtgcccgccgatgtgccggcagcggtg
atcgaccgggcgagggaaatggctgggcaagccttcaaggcgctcggctgcgaggcgatg
gcgcgcgtcgatttcttcctgcgcgccgacggctccctgctggtcaacgaggtcaacacg
ctgcccggtttcaccgacatatcgatgtacgccaaggcgctggccgcgatcggcatcggc
tacagcgaggtcatcgatatcttgatcgagcatgcgctggcgaggcacggcgcgcgctga

DBGET integrated database retrieval system