KEGG   Mesorhizobium australicum: Mesau_03969Help
Entry
Mesau_03969       CDS       T02417                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mam  Mesorhizobium australicum
Pathway
mam00564  Glycerophospholipid metabolism
mam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mesau_03969
Enzymes [BR:mam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Mesau_03969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGB46320
UniProt: L0KNU6
LinkDB All DBs
Position
4042001..4043527
Genome map
AA seq 508 aa AA seqDB search
MDTSSVRDIFVIGGGINGCGIARDAVGRGFSVFLAEMNDLASGTSSGSTKLIHGGLRYLE
FYEFRLVREALMEREVLWKNAPHIIWPMRFVLPYAKGLRPAWLIRLGLFLYDHIGGRKLL
PATRTLDMASDPAGKPLKPLFKKAFEYSDGWVNDARLVALNARDAADRGATIRTRTKVVG
ARREGGIWAIKIEDLQTGETDEVKARLLVNAAGPWVDHVLSGVVGLNDVHNVRLVQGSHI
VIAKKFDDPRAYFFQNRDGRIIFAIPYEDEFTLIGTTDQDYPGDPHDVKISDTEIDYLCA
AASEYFAVPVKRSDIVWTYSAVRPLYDDGASKAQEATRDYVLKADGGDGAAPLVNAFGGK
ITTYRRLSESMLEKIEGFLGKRGKPWTSDAPLPGGDFPATGFDAQVAKLKSAYPFLDQRL
ARRLTRLYGTRVQVLLGLAKSIADLGRNFGGDLHEAEVRYLVENEWAVTAEDVLWRRTKR
GLHLNREQVAALDEFMRGISRQHVAAAE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggacacatcttcagtccgggacattttcgtcataggtggcggcatcaacggctgcggc
atcgcccgtgatgccgtgggacgcgggttctcggtctttctcgccgaaatgaacgatctc
gccagcggaacctcgtccggttcgaccaagctgatccatggcgggctgcgctatctcgaa
ttctatgaattccgcctggtgcgcgaggcgctgatggagcgcgaggttctgtggaagaac
gctccgcacatcatctggccgatgcgcttcgtgctgccctatgccaagggcctgcgcccg
gcctggctgatccggctcggccttttcctttacgaccacatcggcgggcgcaagttgctg
ccggcgaccagaacgctcgacatggcaagcgacccggcgggcaagcctttgaagccgctg
ttcaaaaaggctttcgaatattcggatggctgggtcaacgacgcgcggctggtggcgctg
aatgcacgtgacgccgctgaccggggcgcaacgatccggactcgcaccaaagtggttgga
gcgcgccgcgagggcggaatctgggcgataaagatcgaggacctgcagaccggcgagacc
gacgaggtcaaggcacggttgctggtcaatgcggcgggtccttgggtcgaccacgtgctg
tccggcgtcgtcggcctcaacgacgtgcacaatgtccgcctcgtgcagggcagccacatc
gtcatcgccaagaagttcgacgacccgcgcgcctatttcttccagaacagggatggtcgc
atcatcttcgccatcccctacgaggacgagttcacgctgatcggcaccaccgaccaggat
tatcccggcgacccacatgatgtgaagatcagcgacaccgagatcgactatctctgtgcc
gcagcgagcgagtatttcgcggtgcccgtcaagcgttccgacatcgtctggacctattcg
gccgtgcgtccgctctacgatgacggcgcctccaaggcgcaggaagcgacacgtgactat
gtgctgaaggcggatggcggcgacggcgccgcgccgctggtcaacgcgtttggcggcaag
atcaccacctaccgccggctgtcggaatcgatgctggagaagatcgaaggttttctcggc
aagcgcggcaagccgtggacatcagatgcgccgctgccgggcggcgattttccggccacg
ggtttcgatgcgcaggtggcgaagctgaaaagcgcctatcctttcctcgaccagcgcttg
gcgcgccggctgacgaggctctatggaacgcgtgtacaggtgctgctcggcttggccaag
tcgatcgccgatctcggccgcaatttcggtggcgatctccacgaagccgaggtgcgctat
ctcgtcgaaaacgaatgggctgtcacggcggaagacgtgctgtggcggcggaccaagcgc
ggcctgcatcttaaccgcgagcaggtcgcggcactcgatgaattcatgcgcggcataagc
cggcagcacgtcgcggccgccgaatga

DBGET integrated database retrieval system