KEGG   Mesorhizobium australicum: Mesau_04248Help
Entry
Mesau_04248       CDS       T02417                                 

Definition
(GenBank) translation elongation factor TU
  KO
K02358  elongation factor Tu
Organism
mam  Mesorhizobium australicum
Brite
KEGG Orthology (KO) [BR:mam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mam03012]
    Mesau_04248
   03029 Mitochondrial biogenesis [BR:mam03029]
    Mesau_04248
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mam04147]
    Mesau_04248
Translation factors [BR:mam03012]
 Eukaryotic Type
  Elongation factors
   Mesau_04248
 Prokaryotic Type
   Mesau_04248
Mitochondrial biogenesis [BR:mam03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Mesau_04248
Exosome [BR:mam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mesau_04248
  Exosomal proteins of breast cancer cells
   Mesau_04248
  Exosomal proteins of colorectal cancer cells
   Mesau_04248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AGB46591
UniProt: L0KN86
LinkDB All DBs
Position
complement(4310687..4311862)
Genome map
AA seq 391 aa AA seqDB search
MAKGKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKRYDQIDAAPEEKARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPSIVVFLNKVDQVDDAELLELVELEVRELLSKNEFPGDDIPIVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPVRPLDKPFLMPIEDVFSISGRGTVVTGRVERGVVKVGEEL
EIIGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDREGVERGQVLAKPGTVKPHK
KFVAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPEGTEMVMPGDNITVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVVTIKE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcgcaccaagcctcatgtgaacatcggcacgattggtcac
gtcgaccatggcaaaacgtcgctgacggcggcgatcaccaagtattttggcgaatacaag
cgctacgaccagatcgatgcggcgcctgaagagaaggcgcgcggcatcacgatctcgacg
gctcacgtcgaatacgagaccgccaaccgccactatgcccacgtcgactgccccggccac
gccgactatgtgaagaacatgatcaccggtgccgcgcagatggacggcgcgatcctggtc
gtgtcggccgccgacggcccgatgccgcagacccgcgagcatatcctgcttgcccgtcag
gtcggcgtgccgtcgatcgttgtgttcctgaacaaggtcgaccaggtcgacgacgccgag
ctgctcgaactggtcgagctcgaggttcgcgaactgctgtcgaagaacgaattccccggc
gacgacattccgatcgtcaagggttcggcgctggccgctctggaagattcggacaagaag
atcggcgaggacgcgatccgcgagctgatggctgcggtcgacgcctacatcccgacgccg
gttcgtccgctggacaagccgttcctgatgccgatcgaggacgtgttctcgatctcgggc
cgcggcacggtcgtcaccggccgcgtcgagcgcggcgtggtcaaggtcggcgaggaactg
gagatcatcggcatccgtccgacgaccaagacgacctgcacgggcgtcgaaatgttccgc
aagctgctcgaccagggccaggctggcgacaacatcggcgcgctgttgcgcggcgttgat
cgtgagggtgtcgagcgcggccaggttctggccaagccgggcacggtgaagccgcacaag
aagttcgtggccgaagcttacatcctgaccaaggacgaaggtggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgaccgacgtgaccggcatcgtgtcg
ctgccggaaggcaccgagatggtgatgcccggcgacaacatcacggtcgatgtcgagctg
atcgtgccgatcgccatggaagagaagctgcgcttcgccatccgtgaaggcggccgcacc
gtcggtgccggcatcgtcgtcaccatcaaagagtaa

DBGET integrated database retrieval system