KEGG   Mesorhizobium australicum: Mesau_04320Help
Entry
Mesau_04320       CDS       T02417                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mam  Mesorhizobium australicum
Pathway
mam00970  Aminoacyl-tRNA biosynthesis
mam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mam00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mesau_04320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mam03029]
    Mesau_04320
Enzymes [BR:mam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Mesau_04320
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Mesau_04320
Mitochondrial biogenesis [BR:mam03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mesau_04320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AGB46658
UniProt: L0KRE4
LinkDB All DBs
Position
complement(4381781..4383280)
Genome map
AA seq 499 aa AA seqDB search
MSIIDTRTPDAKRLISGATGDWEIIIGLEVHAQVISEAKLFSGASTAFGAAPNANVSLVD
AAMPGMLPVINEECVKQAIRTGLGLKAQINHKSVFDRKNYFYPDLPQGYQISQFKQPIVG
EGTVIVSVGPDRQGEFEDIEVGIERLHLEQDAGKSIHDQHPTMSYVDLNRSGVALMEIVS
KPDMRSGDEAKAYVTKLRTIMRYLGTCDGNMDEGSLRADVNVSVRRPGGEFGTRCEIKNM
NSIRFIGQAIDYEARRQIAIIEDGGRIDQETRLFDAVKGETRSMRSKEEAHDYRYFPDPD
LLPLEFDQAYVDRLAKELPELPDDKKLRLISSLGLSTYDAAILVSEKPIADYFEKVAAGR
DGKLAANWVINDLLGALNKAGKDIESAPVSPDQLGAVIDLIKEGTISGKIAKDLFEIVWN
EGGDPRQLVESRGMKQVTDTGAIEKAVDEVIAANPDKVEQARAKPSMAGWFVGQVMKATG
GKANPQAVNDLVKAKLGIE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcatcgacactcgcacccctgacgcaaaacgcctgatatccggcgccaccggc
gactgggagatcatcatcggtctcgaggtgcacgcacaggtcatctcggaagcaaagctg
ttctccggcgcttcgaccgctttcggtgccgcgcccaatgccaatgtcagccttgtcgat
gcggcaatgccaggcatgctgcccgtcatcaacgaggaatgcgtcaagcaggcgatccgc
accggcctggggttgaaggcgcagatcaaccacaagtcggtcttcgaccggaagaattat
ttctatccggacctgccgcagggctaccagatctcgcagttcaagcagccgatcgtcggc
gagggcacggtcatcgtctcggtcggccccgaccgccagggcgagttcgaggacatcgag
gttggcatcgagcgcctgcacctggagcaggatgccggcaagtcgatccacgaccagcac
ccgaccatgtcttatgtcgacctcaaccgctccggcgtggcgctgatggagatcgtgtcg
aaacccgacatgcgctccggcgatgaggccaaggcctatgtgaccaagctgcggaccatc
atgcgctatctcggcacctgcgacggcaacatggacgaaggctcgttgcgcgccgacgtc
aatgtctcggtacgccggccaggtggcgaattcggcacgcgctgcgaaatcaagaacatg
aactcgatccgcttcatcggccaggccatcgactacgaggcgcgccggcagatcgccatc
atcgaggacggcggcaggatcgaccaggaaacgcggctgttcgacgccgtcaagggcgag
acgcgctcgatgcgctccaaggaagaggcgcacgactatcgctacttccccgatcccgac
cttctgccgctggaattcgaccaggcctatgtcgataggctggccaaggaattgccggaa
ctgcccgatgacaagaagctgcggctgatctcctcgctcggcctctcgacctacgacgcc
gcgattctggtgtcggaaaagccgatcgccgattatttcgagaaggtggcggccggtcgc
gacggcaagctcgccgccaactgggtcatcaacgatctgctcggtgctctcaacaaggcc
ggcaaggacattgaatccgctccggtttcgccagaccagcttggcgctgtcatcgatctg
atcaaggaaggcaccatctccggcaagatcgccaaggacctgttcgagatcgtctggaac
gagggcggggatccgcgccagctggtcgaaagccgtggcatgaagcaggtcaccgacacc
ggagccatcgagaaggcggtcgacgaggtgatcgcggccaatcccgacaaggtcgagcag
gctcgggccaagcccagcatggccggctggttcgtcggccaggtgatgaaggcgactggc
ggcaaggccaatccgcaggccgtcaacgacctcgtcaaggccaagctgggcatcgagtaa

DBGET integrated database retrieval system