KEGG   Mesorhizobium australicum: Mesau_05270Help
Entry
Mesau_05270       CDS       T02417                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mam  Mesorhizobium australicum
Pathway
mam00630  Glyoxylate and dicarboxylate metabolism
mam00710  Carbon fixation in photosynthetic organisms
mam01100  Metabolic pathways
mam01120  Microbial metabolism in diverse environments
mam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mesau_05270
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesau_05270
Enzymes [BR:mam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mesau_05270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AGB47577
UniProt: L0KQ65
LinkDB All DBs
Position
5335870..5337120
Genome map
AA seq 416 aa AA seqDB search
MITLTYRIETPGSIEALAAKIASDQSTGTFVALPGETEELKARVAARVLAIRHLPDATQP
SLPGSGSGPFRRADVDIAFPFDAIGTDLSALRTIAIGGTYSIRGLSGIRVIDMKLPEQYR
GAHPGPQFGVAGSRGLTGVEGRPIIGTIVKPALGLRPHETAAMVGELIEAGVDFIKDDEK
LMSPAYSPLAERVKAIMPGILDHEQKTGKKVMYAFGISHADPDEMMRNHDLVLQAGGNCA
VVNINSIGFGGMAFLRKRSGLVLHAHRNGWDILTRHPGLGMDFKVWQQFWRLLGVDQFQI
NGIGSKYWEPDDSFIRSFEAVTTPLFSSDDCALPVACSGQWGGQAPETYERTGRTVDLLY
LCGGGIVSHPDGPGAGVRAVLQAWQAAVEGIALADYARDHIELARSIEKFGDGKAA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgcttacctatcgcatcgaaacccctggcagcatcgaggcgctggccgccaag
atcgccagcgaccagtcgaccggcaccttcgtcgcgctgccgggcgagaccgaggagctg
aaggcgcgcgtggcggcgcgcgtgctggcgatccggcacctgccggatgccacgcaaccc
tctctcccgggatccggcagcgggcccttccggcgcgccgatgtcgacatcgccttcccc
ttcgacgctatcggcaccgacctgtcggcactgaggaccattgccattggtggcacctat
tcgatcaggggcctgtccggcatccgcgtcatcgacatgaagctgccggaacaataccgg
ggtgcccatccgggtccacagttcggcgttgcgggcagccgcgggctgaccggtgtcgag
ggccgcccgatcatcggtaccatcgtcaagccggcgcttggtctcaggccgcacgagacg
gccgcgatggtgggcgaactgatcgaggccggcgtcgatttcatcaaggacgacgagaag
ctgatgagccctgcctattcgccgctggcggagcgggtgaaggcgatcatgccagggatt
ctcgaccatgagcagaagaccggcaagaaggtgatgtatgccttcggcatctcgcatgcc
gatcccgacgagatgatgcgcaaccacgatcttgtgctccaagccggcggcaattgcgcg
gtcgtcaacatcaactcgatcggcttcggtggcatggcttttctgcggaagcgttccggc
ttggtgctgcatgcccatcgcaatggctgggacattctcacacgccaccccggcctcggc
atggacttcaaggtctggcagcaattctggcggctgctcggcgtcgaccagttccagatc
aacggcatcggctcgaaatattgggagccggacgattccttcatccgctccttcgaggca
gtgacgacgccgctgttttcatcagacgattgcgcgctgcccgtggcctgctcgggccaa
tggggcggccaggcacccgaaacctatgagcgcaccggccgcacggtcgacctcctctac
ctctgcggcggcggcatcgtcagccatccggacggacccggtgccggcgtgcgggccgtg
ctgcaagcctggcaggcggcggtcgagggcattgcgctggcggactatgcccgcgatcac
atcgaactggcccgatcgatcgaaaagttcggcgacggcaaggcagcatga

DBGET integrated database retrieval system