KEGG   Mesorhizobium australicum: Mesau_05352Help
Entry
Mesau_05352       CDS       T02417                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
mam  Mesorhizobium australicum
Pathway
mam00220  Arginine biosynthesis
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01130  Biosynthesis of antibiotics
mam01210  2-Oxocarboxylic acid metabolism
mam01230  Biosynthesis of amino acids
Module
mam_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Mesau_05352
Enzymes [BR:mam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     Mesau_05352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AGB47659
UniProt: L0KUI3
LinkDB All DBs
Position
complement(5424276..5425577)
Genome map
AA seq 433 aa AA seqDB search
MPERIADEAILRAVDEGFDRQLAFLADLVRFPSQRGEEHAAQSFMAAAYEANGYAVDMWR
VDVDAIRDLPGFSPVAVSYDDAFNVVATHTPKNVTGRSLILNGHIDVVPTGPLDRWVRDP
YDPAIEDGWMHGRGAGDMKAGLSACLYALAALRGLGYQPAAKVFLQSVVEEECTGNGALA
CLQRGYRADAAFIPEPLEPRLMRAQVGPIWFKVEVDGDPQHASGAFSAGANAIEKAFLII
QALKQLEIVWNARKVDDRHFCNHPHPIRFNLGKIQGGEWTSSVPARCVFEMRVATYPGQK
LEDARAELEACIADAARADPFLANRPPRMTYNGFMAEGYVLEGADEMEAVLRRSHTAVWG
EPLTEHVTSATTDARFFGLYADTPAIVYGPICRMPHGYDEAVDLDSVRKVTQTIALFIAD
WCGLEPIDAEVRP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacgaattgcggacgaggccatcttgcgggcggtcgacgagggctttgaccgc
cagctcgccttcctggcggacctcgtacgctttccctcgcagcgcggtgaggaacacgcc
gcgcaatccttcatggcggctgcttatgaagccaatggctatgcggtcgatatgtggcgt
gtcgatgtcgatgcgatccgcgacctgcctggattctcgcccgtagcggtttcctacgat
gacgcgttcaacgtcgtcgccacccacacgccgaaaaacgtcaccggtcgctcgctgatc
ctcaacggccatatcgatgtggtaccgaccggaccgctcgaccgctgggtgcgagatccc
tacgatccggcgatcgaggatggctggatgcatggccgtggcgccggcgacatgaaggcg
ggcctgtcggcctgtctctatgcgttggccgccttgcgcggcctcggctatcagcctgcg
gcgaaagtgttcctgcagtcggtggtcgaggaggagtgcaccggcaatggtgcgctcgct
tgcctgcagcgcggttatcgcgccgacgccgccttcattcccgaaccgctggaaccaaga
ttgatgcgggcgcaggttgggccgatctggttcaaggtcgaggtcgacggcgatccgcag
cacgcgtcgggcgccttttccgccggcgccaatgccatcgagaaggcgtttctcatcatc
caggcgctgaagcaactcgaaatcgtctggaatgccagaaaggttgacgacaggcatttc
tgtaatcacccgcacccgatccgattcaacctcggcaagatccaaggcggcgaatggaca
tcgagcgttcccgcccgctgcgtcttcgagatgcgggtcgcgacctatcccggccagaag
ctcgaggacgccagggccgaactcgaggcctgcatcgccgatgccgcccgcgccgatccg
ttcctcgccaatcgcccgcccaggatgacctataacggcttcatggccgagggctatgtg
ctggaaggcgccgacgagatggaagccgtgctgcgccgcagccacaccgccgtgtggggt
gagccgttgacggaacatgtcacctcggccaccaccgatgcgcgcttcttcggcctttat
gccgacacgccggcaatcgtctacggcccgatctgccgcatgccgcatggctatgacgag
gctgtcgatctcgattccgtgcgcaaggtcacccagaccattgcgctcttcatcgccgac
tggtgcggcctcgaacccatcgatgccgaggtcaggccatga

DBGET integrated database retrieval system