KEGG   Mesorhizobium amorphae: A6B35_02285Help
Entry
A6B35_02285       CDS       T04446                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00473  D-Alanine metabolism
mamo01100  Metabolic pathways
mamo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A6B35_02285
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A6B35_02285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mamo01011]
    A6B35_02285
Enzymes [BR:mamo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A6B35_02285
Peptidoglycan biosynthesis and degradation proteins [BR:mamo01011]
 Precursor biosynthesis
  Racemase
   A6B35_02285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANT48848
UniProt: G6YGI8
LinkDB All DBs
Position
complement(488290..489438)
Genome map
AA seq 382 aa AA seqDB search
MNDASKNVPESIATQGEPVSEAVAGAILTIDLGAIRENYRRLKAQLGGVPCAGVVKADGY
GLGAAPVARALSAEGCTTFFVALLAEGLALRKGLGPGPAIHVLNGLPPGSEPEAVAAELV
PVINSAGQLKAWGEAGQQAGRKLPAAIQVDSGMSRLGMPPAEVQAIAADPRAFDGVNVVL
VMSHLACADELQHPANERQWLAFERLRKMMPEAPASLANSSGIFLGTAFHFDLARPGAAL
YGINPTPSEPNPMLPVVRLQAKIVQTRSLEKGAGVGYGHTFRATGPLRAATISLGYADGW
HRRAASAAWFDTVRLPFLGRVSMDSIILDISALPVGTLGEGDLVELLGPSQSVDEAAGHA
GTIGYEILTSLGPRFHRRYVNG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcctccaaaaacgtccccgaaagcatcgccacgcaaggtgagccggtcagt
gaagcggtggccggcgccatcctgaccatcgatctcggcgccatccgtgaaaactaccgg
cggctgaaggcgcaattgggcggcgtgccgtgcgccggtgtcgtcaaggccgatggttat
ggcctgggcgcggcgcccgtggcaagggcgctgtcggccgagggctgcaccactttcttc
gtcgcgctgctcgccgaaggcctggcgctgcgcaaggggctcggccccggaccggcgatc
catgtcctcaacggcctgccgcctggctcggaaccggaagcggttgcggcggagcttgtt
cccgtcatcaacagcgccggccagctgaaggcctggggtgaagccggccagcaggccggc
cgcaagctgccggccgcgatccaggtcgacagcggcatgtcgcggctcggcatgccgccg
gcggaggtgcaggcaatcgccgccgatccgcgcgctttcgacggcgtcaacgtcgtcctg
gtgatgagccatctcgcctgcgccgacgagctgcagcatccggccaatgagcggcagtgg
ctggccttcgaacggttgcgcaagatgatgccagaagcgcctgcttcgctcgccaattcg
tccggcatcttcctcgggacggcctttcatttcgacctcgcccgtcctggggcggcgctc
tacggcatcaatccgacgccgagcgaaccgaacccgatgctgccggtggtgcggctgcag
gcgaaaatcgtccagacgcgcagcctcgaaaagggggcaggcgtcggctatggccataca
tttcgcgcaaccggcccgttgagagctgcgacgatctcgctcggctatgccgacggctgg
catcgccgcgccgcctcggccgcctggttcgacactgtccggctgccctttctcggacgc
gtatcgatggattcgatcatcctcgacatttccgcgctccccgtgggcacgctcggcgag
ggtgaccttgtcgaactgctcggcccgtcgcagagcgtcgacgaggcggccggccatgcc
ggcacgatcggctacgagatcctgaccagcctcgggccgcgctttcaccggcgctacgtg
aacgggtag

DBGET integrated database retrieval system