KEGG   Mesorhizobium amorphae: A6B35_02955Help
Entry
A6B35_02955       CDS       T04446                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00500  Starch and sucrose metabolism
mamo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A6B35_02955
Enzymes [BR:mamo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     A6B35_02955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Prenyltrans Corona_3
Motif
Other DBs
NCBI-ProteinID: ANT48967
UniProt: G6Y6W3
LinkDB All DBs
Position
640272..642683
Genome map
AA seq 803 aa AA seqDB search
MAATPTVAQGAPGIPARWTSSAKSGVGTALSAASRVWFTISHGILNEIYYPRLDSACTRD
FGLIVTGPDGAFSEEKRDARHEIAPFEDGVAGYSLINTAADGTWRVEKRIVTDPKCPALL
QEITFTPLKGSAADCRVYALLAPHLVNAGMGNTAWVGEHKGKPVLFASGRGVSLALASSL
PWGSCSAGYVGFSDGWQQLRRDGRLDPACQRAEDGNVALTGEIGFSAKATKALLALGFGA
TPEEAADNAYAGLKRGFEPVANSYLQRWRQWQDGLLPLDRHAASGLNTYRVSTAVLATHR
SFAVPGAAVASLSIPWGFSKGDDDLGGYHLVWPRDLVETAGGFLAAGDAGEALRILAYLR
SIQQPDGHWPQNVWLDGSAYWPGIQMDECAFPLLLADALRRAGHLSGTALSAFMPMIESA
ASYVVRNGPVTGEDRWEEDAGYSPFTLAVEISALLAAADMFDVSGKTEPANYLRETADCW
NDQIERWTYVTGTNLCTDAGVKGYYVRIAPPDASGVASPKDGFVPIKNRPPGDTNRPAEA
IVSPDALALVRFGLRAADDPRILDTLKVIDATLCCDLPQGPLWYRYTGDGYGEHEDGAPF
DGTGQGRPWPLLAGERAHYELAAGRKDKAEELLETFEASAGEGGLLPEQVWDGPDVPERE
LRRGAPSGSAMPLVWAHSEHIKLLRSLRDGAVFDMPPQGAKRYIEHKTVSPLRIWRFNNK
IRTVPAGKVLRVELSARGVVHWTTDKWLTVQDSKTAENAFGVHLVDLPVNEMPPGNTIVF
TFFWPDTARWENVDFSVGIDEPD
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgacgccgactgttgctcagggcgccccggggataccggcgcgttggacgtca
agcgccaagagcggcgtcggcaccgcactttcagcggccagccgcgtctggttcaccatc
agccacggcattttgaacgagatctactatccgcgcctcgacagtgcctgcacccgcgac
ttcggtctgatcgtcaccggccccgacggcgctttctccgaagaaaagcgcgatgccagg
catgagatcgcgccgttcgaggatggcgtggccggctacagcctgatcaacaccgccgcc
gacggaacatggcgggtcgaaaagcgcatcgttacggacccgaaatgccctgctctgctg
caggagataaccttcacgccgctgaaaggttcggctgccgattgccgcgtctacgcgctg
ctggcgccgcatttggtcaatgccggcatgggcaataccgcctgggtgggcgagcacaag
ggcaagcctgtcctgttcgcctccgggcgcggcgtctcgctggcgctcgcctcctcgctg
ccctggggctcctgttcggccggctatgtcggcttttccgacggctggcagcaactccgg
agggatggccgcctcgacccggcctgccaaagggccgaagacggcaacgtggcgctgacc
ggcgagatcggcttttccgccaaggcaaccaaggccctgctggcgctcggcttcggcgcg
acgccggaggaagcggccgacaatgcttatgccggcctgaagcgaggcttcgagccggtg
gcgaattcttatctccagagatggcgccaatggcaggacggcctgctgccgctggaccgc
catgcggcgtccggcctcaacacctaccgcgtcagcaccgcggtcctggccacgcaccgt
tcgttcgccgtgcctggcgcggcggttgccagcctgtcgatcccctgggggttcagcaag
ggcgacgacgatctcggcggctaccatctcgtctggccgcgcgacctggtcgagacggcg
ggcggctttctggccgcaggcgacgccggtgaggcgctgcgcatcctcgcctatctccgc
tcgatccagcagccggacggccattggccgcagaacgtttggctcgacggctcggcctac
tggccgggcatccagatggatgaatgcgcctttccgctgctgctcgccgacgcgctgcgc
cgcgccggccacctctcgggcaccgcgctgtccgccttcatgccgatgatcgagagcgcg
gcgtcctatgtcgtgcgcaatggcccggtcaccggtgaggaccggtgggaggaagatgcc
ggctatagcccgttcacgcttgccgtcgagatatcagctttgctcgcggcggcggacatg
ttcgacgtctcgggaaaaacggagccggcaaactatctgcgcgaaaccgccgattgctgg
aacgaccagatcgagcgctggacctatgttactggcacgaacctatgcacggacgccggc
gtcaaaggctactatgtccgcatcgcgccgccggacgcttcaggggtagcgtcgccgaag
gacggctttgtccccatcaagaaccggccgcccggcgatacgaaccgtccggccgaagcg
atcgtcagccctgatgctctggcattggtccgcttcggacttagggcggcggacgatccg
cgcatcctcgatacgctgaaggtgatcgacgccacgctgtgctgcgacctgccgcaaggg
ccgctctggtatcgctatacgggcgacggctatggcgaacatgaggacggcgcgcccttc
gacggaaccggccaaggccggccctggccgctgctggcaggtgaacgcgcccattacgaa
ctggcggctgggcgaaaggacaaagcggaagagctgctcgaaaccttcgaagcctcggcc
ggagagggcggcctgctgcccgagcaggtctgggatggccccgacgtgccggagcgcgaa
ttgcggcgtggcgcaccgtcgggcagtgccatgccgctggtctgggcgcattccgagcac
ataaaactgctgcgttcgctgcgcgacggcgccgtgttcgacatgccgccgcaaggcgca
aaacgctacatcgagcacaagaccgtctcgccgctcaggatatggcgcttcaacaacaag
atccgcacagtcccggccggcaaggtgctgcgcgtggaactctcggcacgtggcgtggtg
cactggacgacagacaaatggctgaccgtgcaggacagcaagactgcagagaatgccttc
ggcgtccatctggtggacctgccggttaacgagatgccgccgggcaacaccatcgtcttc
acttttttctggcccgacaccgcccgttgggagaatgtcgacttctccgtcggcatcgat
gagccggactag

DBGET integrated database retrieval system