KEGG   Mesorhizobium amorphae: A6B35_12475Help
Entry
A6B35_12475       CDS       T04446                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mamo  Mesorhizobium amorphae
Brite
Enzymes [BR:mamo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A6B35_12475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANT50673
UniProt: G6Y314
LinkDB All DBs
Position
2708480..2709076
Genome map
AA seq 198 aa AA seqDB search
MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGMGDLSVEDVVKQS
FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGALQKAFDSDLGGYDKFKADFIAAGT
TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDHVLELYEKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgcccgctctgccgtacgactacgaggcgctccagccttacatgtcg
aaggagacgctggaataccaccacgacaagcaccacaaggcctatgtcgacaacggcaac
aagctggccgccgaggccgggatgggcgacctgtcggtcgaggacgtggtgaagcagtcc
ttcggcaagaatgccgggctcttcaacaacgccgcccagcattacaaccacatccatttc
tggaagtggatgaagaagggtggcggcggcaacaagctgccgggcgcgctgcagaaggcc
ttcgacagcgaccttggcggctacgacaagttcaaggcggacttcatcgccgccggcacc
acccagttcggctcgggctgggcctgggtttcggtcaaggacggcaagctggcgatctcg
aagacgccgaatggcgagaacccgctggtccatggcgccacgccgatcctcggcgtcgac
gtctgggagcactcctattacatcgactaccgcaatgcccggcctaagtacctcgaggcc
ttcgtcgacagtctcatcaactgggaccacgtcctcgaactctacgaaaaagcctga

DBGET integrated database retrieval system