KEGG   Mesorhizobium amorphae: A6B35_15235Help
Entry
A6B35_15235       CDS       T04446                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00290  Valine, leucine and isoleucine biosynthesis
mamo00770  Pantothenate and CoA biosynthesis
mamo01100  Metabolic pathways
mamo01110  Biosynthesis of secondary metabolites
mamo01130  Biosynthesis of antibiotics
mamo01210  2-Oxocarboxylic acid metabolism
mamo01230  Biosynthesis of amino acids
Module
mamo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mamo_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    A6B35_15235
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A6B35_15235
Enzymes [BR:mamo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     A6B35_15235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: ANT51175
UniProt: G6YIS2
LinkDB All DBs
Position
3267708..3269411
Genome map
AA seq 567 aa AA seqDB search
MTSYGDAAFSLFLRKAFIKAAGYSDDALDRPIVGIVNTTSDYNPCHGNAPQLIEAVKRGV
MLSGALPMVFPTISIHESFAHPTSMVLRNLMAMDTEEMIRAQPMDAVVVVGGCDKTLPAQ
IMGAISADLPTVVVPVGPMVVGHHKGETLGACTDCRRLWSGHRAGEIDAAEIELVNGRLA
PSVGTCMVMGTASTMAIIAETIGLTVPYAASIPAPLAERVRSAEASGRVAAALAVSGRPF
PSELVTPAALRNAMVVMQAIGGSTNGIIHLAAIAGRAGHAIDLAEFDRIGREVPVLVDLK
PSGEHYMEHFHEAGGVPRLLAELTGFLDLTVPVIGGGTLADRVMKREHMHDQHVIRPLGQ
PLKAQGAMAVLSGNLCPRGAVIKHSAASPALMQHTGRAVVFESVADLAERIDDPDLDVAA
DDVLVLRNAGPKGAPGMPEAGYIPIPKKLAAEGVKDMVRLSDARMSGTAFGTVILHVSPE
AAAGGPLALVRNGDRIRLDVAGRRIDVLIDDAELARRAAAARPAVERPERGYAQLYHDHV
LQADQGCDFDFLTATPAAADDIEEAAQ
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagctacggcgacgccgccttttcgctgttcttgcgcaaggccttcatcaaggcc
gccggttactccgacgatgcgctggaccggccgatcgtcggcatcgtcaacaccaccagc
gactacaatccctgccatggcaacgccccgcagctgatcgaggcggtcaagcgcggcgtc
atgctgtcgggcgcgctgccgatggtgttcccgaccatctcgatccacgaatccttcgcc
cacccgacctcgatggtgttgcgcaatctgatggcgatggacaccgaggagatgatccgc
gcccagccgatggatgctgtcgtcgtcgtcggtggttgcgacaagaccttgccggcgcag
atcatgggtgcgatcagcgccgacctgccgacggtcgtggttccggtcgggccgatggtg
gtcggccatcacaagggcgagacgctcggcgcctgcaccgattgccgccggctgtggtcg
ggccatcgcgccggcgagatcgacgctgccgagatcgagctggtcaacggccggctggcg
ccttccgtcggcacctgcatggtgatgggcaccgccagcaccatggccatcatcgccgag
accatcggcctcactgtcccctatgcggcctcgattccggcgccgctggccgagcgggtc
cgttcggcggaggcgtcgggccgggtcgccgccgcgcttgccgtcagcggcaggccgttt
ccgagcgagctcgtcaccccggcggcattgcgcaacgccatggtcgtcatgcaggcgatc
ggcggctcgaccaacggcatcatccatctggcggcgattgcgggccgggcagggcacgcg
atcgatctcgccgaattcgacaggatcggccgcgaggtgccggtgctggtcgacctgaag
ccgtcgggcgagcactacatggagcatttccacgaggcgggcggcgtcccgcgcctgctc
gccgaactcaccggcttcctcgatctcacggtgcccgtcatcggcggcggcacgctggcc
gaccgcgtgatgaagcgcgagcacatgcatgaccagcatgtcatccggccgctcggccag
ccgctgaaagcgcaaggcgccatggccgtgctgtcgggcaatctctgcccgcgcggcgcc
gtcatcaagcattcggcggcctcgccggcgctgatgcagcataccggccgtgccgtggtc
ttcgaatcggtcgccgaccttgccgagcgcatcgacgaccccgatctcgacgtcgccgcc
gacgatgtgctggtgctgcgcaatgccgggccgaagggcgcgcccggcatgccggaggcc
ggctacatcccgatcccgaagaagctcgccgccgaaggcgtcaaggacatggtccgcctc
tcggatgcgcgcatgagcggcaccgccttcggcaccgtcatcctgcatgtatcgccggaa
gccgccgcgggtggtccgctcgctttggtgcgcaacggcgaccggatcagactggatgtc
gccgggcggcgcatcgacgttctcatcgacgacgcggaactggccaggcgcgccgccgca
gcaaggcccgccgtcgagcggcccgaacgcggctatgcccagctctaccacgaccacgtc
ctgcaggccgaccagggttgcgacttcgacttcctgaccgccacgccggcggcggcagac
gatatcgaggaggcagcgcaatga

DBGET integrated database retrieval system