KEGG   Mesorhizobium amorphae: A6B35_16815Help
Entry
A6B35_16815       CDS       T04446                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00910  Nitrogen metabolism
mamo02010  ABC transporters
Module
mamo_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    A6B35_16815
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A6B35_16815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mamo02000]
    A6B35_16815
Transporters [BR:mamo02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    A6B35_16815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ANT51443
UniProt: G6YJG1
LinkDB All DBs
Position
3596903..3597799
Genome map
AA seq 298 aa AA seqDB search
MSIQAIEDTKVKAFPAPAEPSKVIAFATKARRRFDPLAIVNKLASTLLPPAVVIVLMLVV
WQVACSSPTSSLPPPSQVWNEAYDLIAHPFFDNGPQDIGLAWRVLISLQRVAIGFGLAAI
VGVALGALVGQSVWAMRGLDPVFQILRTVPPLAWLPLSLAAFRDSSPSAIFVIFITSIWP
VIINTAVGVRNIPEDYRNVSRILRLNQIEFFVKIMVPAAAPYIFTGLRIGIGLSWLAIVA
AEMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVTGFCLDRLVATVGTFVTRGTTAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatccaagccatcgaggacaccaaggtgaaggcgtttcccgcgccggccgagccg
tcaaaggtgatcgctttcgccacaaaggcgcggcgccgtttcgacccgctcgcgatcgtg
aacaaattggcaagcacgctgctgccgccggccgtcgtcatcgtactcatgctcgtcgtc
tggcaggtcgcctgctcgtcgccgacctccagcctgccgccgccgagccaggtgtggaac
gaggcctatgacctgatcgcgcatcccttcttcgacaatggcccgcaggatatcgggctc
gcctggcgggtgctgatctcgctgcagcgggtcgccatcggatttggcctcgcggcaatc
gtcggtgtcgcgctcggcgcgctggtcggccagtcggtgtgggcgatgcgcggcctcgat
ccggtgttccagatcctgcgcaccgtgccgccgcttgcctggctgccgctgtcgctggcg
gctttccgcgattccagcccgtcggcgatcttcgtcatcttcatcacctcgatctggccg
gtgatcatcaacaccgccgtcggcgtccgcaacatccccgaggactaccgaaacgtctcg
cgcatcctgcggctcaaccagatcgagttcttcgtcaagatcatggtgccggcggcagcg
ccctacatcttcaccggcctgaggatcggcatcggcctgtcctggctcgccatcgtcgcc
gccgaaatgctgaccggtggcgtcggcatcggcttcttcatctgggatgcgtggaactcg
tcgcggctgcccgacatcatcgtcgcgcttgcctatatcggcgtcaccggcttttgcctc
gaccgcctggtcgcgacggtcggcaccttcgtcacccgcggcacaacggcaaagtga

DBGET integrated database retrieval system