KEGG   Mesorhizobium amorphae: A6B35_18480Help
Entry
A6B35_18480       CDS       T04446                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00564  Glycerophospholipid metabolism
mamo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A6B35_18480
Enzymes [BR:mamo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A6B35_18480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_3 NAD_binding_8 FAD_oxidored STPPase_N GIDA
Motif
Other DBs
NCBI-ProteinID: ANT51747
UniProt: G6Y9E4
LinkDB All DBs
Position
3941827..3943353
Genome map
AA seq 508 aa AA seqDB search
MDASPIHDIFVIGGGINGCGIARDAAGRGFSVFLAEMNDLASGTSSGSTKLIHGGLRYLE
FYEFRLVREALMEREVLWKNAPHIIWPMRFVLPYAKGLRPAWLIRLGLFLYDHIGGRKLL
PATKTLDMAKDPAGKPLKPLFRKAFEYSDGWVNDARLVALNARDAADRGATIRTRTKVVS
ARREGDLWAIRLEDVHTGQAEEVKARLLVNAAGPWVDQVLSATVGLNDVHNVRLVQGSHI
VINKKFDDPRAYFFQNKDGRIIFAIPYEEEFTLIGTTDRDYPGDPHEVKISDAEIDYLCT
AASEYFAQGVKRSDIVWTYSAVRPLYDDGASKAQEATRDYVLKADGGEGAAPIVNAFGGK
ITTYRRLSESMLEKIEAFLGKRGKPWTANAPLPGGDFPATGFDVEVAKLKTAYPFLDARL
ARRLTRLYGTRARTLLGLARSNADLGRNFGADLYEAEVRYLVQNEWAMTAEDVLWRRTKR
GLQLSREQAGALDEFMRGISRRHVAAAE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
ttggacgcatctccgatccatgacattttcgtcatcggcggcggcatcaacggctgcggc
atcgcccgtgacgctgccggacgtggcttttcggtttttctggccgagatgaacgatctg
gccagcggaacgtcgtccggctcgaccaagctgatccatggcggcctgcgctatctcgaa
ttctatgaattccgtctggtgcgcgaagcgctgatggaacgtgaggtgctctggaagaac
gcgccccacatcatctggccgatgcgcttcgtgctgccttacgccaagggcctgcgcccg
gcctggctgatccggctcggcctgttcctctatgaccatattggcgggcgcaaattgctg
ccggcgaccaagacgctggacatggcgaaggatccggccggcaagccgctgaagccgctg
tttcgcaaggctttcgaatattccgacggctgggtcaacgatgccaggctggtggcgctc
aacgcacgcgacgccgccgaccgcggcgcaaccatccgaacccggacgaaggtggtcagc
gcacgccgcgagggtgatctctgggcgataaggctggaagacgtccacaccgggcaagcg
gaagaggtcaaggcgcggcttctggtcaatgccgccggtccttgggtcgaccaggtgctg
tcggcaacggtcggcctgaacgacgtgcacaatgtccgcctggtgcagggcagccacatc
gtcatcaacaagaagttcgacgatccgcgcgcctactttttccagaacaaggatggccgc
atcattttcgccatcccttatgaggaagaattcacgctgatcggcaccaccgaccgggat
tatccgggcgatccgcacgaggtgaagatcagcgacgccgagatcgactatctgtgcacc
gcggcgagcgaatatttcgcgcagggcgtcaagcgttcggacatcgtctggacctattcc
gccgtgcgcccgctctatgacgatggcgcctcgaaggcgcaggaagcgacccgcgactat
gtgctcaaggccgacggcggcgagggcgcggccccgatcgtcaacgcctttggcggcaag
atcaccacctatcgccggctgtcggaatcgatgctggaaaagatcgaagctttcctcggc
aagcgcggcaagccgtggaccgccaacgctcctttgcccggcggcgatttcccggccacc
ggtttcgacgtcgaagtggcgaagctgaagaccgcctatccgtttctcgatgcgcgcctg
gcccgccggctgacccgcctctacggcacccgtgctcgcaccctgctcggcctcgccagg
tcgaatgccgacctcggccggaatttcggcgctgatctctacgaggccgaggtgcgctat
ctcgttcaaaacgagtgggcgatgacggcggaagatgtattgtggcgccggaccaagcgc
ggcctgcagttgagccgcgagcaggcgggtgcactggacgaattcatgcgcggaataagc
cggcgccatgtcgcggcggcagaataa

DBGET integrated database retrieval system