KEGG   Mesorhizobium amorphae: A6B35_24600Help
Entry
A6B35_24600       CDS       T04446                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00010  Glycolysis / Gluconeogenesis
mamo00620  Pyruvate metabolism
mamo01100  Metabolic pathways
mamo01110  Biosynthesis of secondary metabolites
mamo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A6B35_24600
   00620 Pyruvate metabolism
    A6B35_24600
Enzymes [BR:mamo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     A6B35_24600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ANT52840
UniProt: G6YLR9
LinkDB All DBs
Position
5253484..5255001
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRSVRAPFDKRYGNFIGGKWAEPRSGRYFENFSPVNGQLLCEVARSDAQDIEAA
LDAAHAAKDAWGRTSVAERSLILNRIADRMEENLDLLARAETWDNGKPIRETTAADLPLA
IDHFRYFAGALRGQEGSLSQIDDDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAA
GNCVVLKPAEQTPAAILLWADLVGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVVAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALIHESIYDTFMERALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYIDIGRQ
EGAEVLTGGARNVLPGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVTTFKDDDEALS
IANDTLYGLGAGVWTRDANRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattctcacgctcggtcagggcgcccttcgacaagcgttacggcaat
ttcatcggaggcaaatgggccgagccgcgctccggccgctacttcgaaaacttctcgccg
gtgaacggccagctgctgtgcgaggtggcgcgctcggatgcccaggacatcgaagcggcc
ctggacgccgcgcatgccgccaaggacgcctggggccgcaccagcgtggccgagcggtcg
ctcatcctcaaccgcatcgccgatcgcatggaggaaaacctcgatctcctcgctcgcgcc
gaaacctgggacaacggcaagccgatccgcgaaacgaccgcggccgatctgcctttggcc
atcgaccatttccgctatttcgccggcgccttgcgtggccaggaaggcagcctttcccag
atcgacgacgataccgtcgcctatcatttccatgagccgctcggcgtggtcggccagatc
atcccgtggaacttcccactgctgatggcatgctggaaacttgctccagcgcttgcggcc
ggaaactgcgtggtgctgaagcctgccgagcagaccccggctgccatattgctgtgggcc
gatcttgtcggcgatctgctgccgccgggcgtgctcaacatcgtcaacggtttcggcctc
gaggccggcaagccgctggcgtcctcgccgcgcattgccaagatcgcctttaccggcgag
accacgacgggccggctgatcatgcagtatgccagccagaaccttatccccgtcacgctg
gaactgggcggcaagtcgcccaacatcttcttcaaggacgttgtcgccgaggacgacgat
ttcttcgacaaggcgatcgaaggcttcgtcatgttcgcgctgaaccagggcgaggtctgt
acctgccccagccgtgcgctcatccatgaatcgatctacgacaccttcatggaacgtgcc
ctcaagcgcgtcgaggcgatcgtgcagggcgatccgctcgatccggcgacgatgatcggt
gcccaggcctcgtccgagcagttggaaaagatcctgtcctacatcgacatcggccgccag
gaaggcgcggaagtgctgaccggcggcgcccgcaacgtcctgcccggtgatctggcgggc
ggctattacgtcaagccgacggtgttcaagggccacaacaagatgcgcatcttccaggag
gagattttcgggccggtggtttcggtcacgaccttcaaggacgacgacgaagcgctcagc
atagccaacgatacgctctacggcctcggcgccggcgtctggacgcgagacgccaaccgc
gcctatcgcttcggccgcgcgatccaggctggccgcgtctggaccaactgctaccacgcc
tatccggctcacgccgccttcggcggatacaagcaatccggcatcggccgcgagacccac
aagatgatgctcgaccactaccagcagaccaagaacatgctggtaagctatagcccaaag
aagcttggcttcttttga

DBGET integrated database retrieval system