KEGG   Mesorhizobium amorphae: A6B35_26690Help
Entry
A6B35_26690       CDS       T04446                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mamo  Mesorhizobium amorphae
Pathway
mamo00240  Pyrimidine metabolism
mamo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mamo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    A6B35_26690
Enzymes [BR:mamo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A6B35_26690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14
Motif
Other DBs
NCBI-ProteinID: ANT53205
UniProt: G6YD90
LinkDB All DBs
Position
5692788..5693399
Genome map
AA seq 203 aa AA seqDB search
MAKLYFNYATMNAGKTTMLLQASYNYRERGMTTMLFVAGHYRKGDTGLISSRIGLETEAE
MFRDGDDLYARVAEHHDHATVHCVFVDEAQFLEEGQVWQLARIADRLNIPVMCYGLRTDF
QGKLFSGSRALLAIADDLREVRTICRCGRKATMVVRLGPDGKVARQGEQVAIGKDVYVSL
CRRHWEEEMGRAAPDDFIGFTRA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttattttaactatgcgacgatgaatgccggcaagacgacgatgctgcta
caggcgtcctacaattatcgcgaacgcggcatgacgacgatgctgttcgtcgccggccac
taccgcaagggcgacaccgggctgatctcgtcgcgcatcggcctggaaacggaggccgag
atgtttcgtgacggcgacgacctctacgcccgcgtcgccgagcatcacgaccacgcgacc
gtgcattgcgtcttcgtcgacgaggcgcagttcctcgaggaaggtcaggtctggcaactc
gcccgcatcgccgaccggctgaacatcccggtcatgtgctacggcctgcgcaccgatttc
cagggcaagctgttctccggttcgcgcgcgctgctggcgattgccgacgatctgcgcgaa
gtgcgaaccatctgccgctgcggccgcaaggcgacgatggtcgtgcgcctcggcccggac
ggcaaggtggcgaggcagggcgagcaggtggcgatcggcaaagacgtctatgtctcgctc
tgccgccgccactgggaagaggaaatgggcagggcggcgcccgacgatttcatcggcttc
accagggcctga

DBGET integrated database retrieval system