KEGG   Methylomusa anaerophila: MAMMFC1_00584Help
Entry
MAMMFC1_00584     CDS       T05819                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mana  Methylomusa anaerophila
Pathway
mana00473  D-Alanine metabolism
mana00550  Peptidoglycan biosynthesis
mana01100  Metabolic pathways
mana01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mana00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MAMMFC1_00584 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MAMMFC1_00584 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MAMMFC1_00584 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mana01011]
    MAMMFC1_00584 (ddlA)
Enzymes [BR:mana01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MAMMFC1_00584 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:mana01011]
 Precursor biosynthesis
  Amino acid ligase
   MAMMFC1_00584 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 GARS_A RimK ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST DUF4988
Motif
Other DBs
NCBI-ProteinID: BBB89944
UniProt: A0A348AFU6
LinkDB All DBs
Position
complement(654778..655881)
Genome map
AA seq 367 aa AA seqDB search
MKKIRVGILFGGRSAEHEVSLQSAQNIIDAIDKDKYDVTLIGIDKQGQWHLNDKSQFLLN
SNDPKLIALNKSGKNVMLIPGSPKQQLIHTADQGADAGMDVIFPVLHGSYGEDGTVQGLL
KLANIPFVGAGVLGSAVGMDKDVMKRLLRDAGIPIASFKVYYGWEQDNMDFAGAVKELGL
PLFVKPANMGSSVGVSKVRNEAEFMAAMKEAFRFDNKVLVEEFVPGREVECAVLGNDSPI
ASAVGEIIAQQDFYSYEAKYIDENGAVLEIPAKISPAASKEIQDIAIKAFKVLCCEGMAR
VDCFLTPENGVIVNEINTIPGFTRISMYPKLWEISGIAYSDLIDRLIQLALERHTREQRL
QTSYAKT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagggttggaattttgtttggcggcagatctgccgaacatgaagtatcg
ttgcagtcggcccaaaatatcatcgacgcaattgacaaggataagtacgatgttacgctt
atcggaattgataagcagggacagtggcatttaaatgacaaatcccagtttttgctcaac
agcaatgatccgaaactgattgccctaaataaaagcggaaaaaatgttatgctgatcccc
ggcagtcccaagcaacaactgattcataccgccgatcagggcgccgatgccggtatggat
gtaatcttcccggttctgcacggttcgtatggcgaagacgggacggtgcaaggattgctg
aaactggcgaatattcctttcgtcggggcgggagtattgggatcagcggtgggaatggac
aaagatgtaatgaagcggcttttgcgggacgcgggaattcctatcgccagctttaaagtt
tactatggctgggaacaagacaacatggattttgccggtgctgtgaaggaattaggcctg
ccgcttttcgtcaaaccggctaacatgggatcatcagtcggggttagcaaagtgcggaac
gaagccgagtttatggctgcaatgaaagaagccttccggtttgacaacaaggtgctggtg
gaagaatttgtaccggggcgggaagtagaatgcgccgttctcggcaacgacagtccgatt
gcctcggcggttggtgaaattatcgcccagcaggatttttattcttatgaagcaaaatat
attgatgaaaacggggcagttcttgagatacccgcgaaaatttccccggcggcgagtaaa
gagattcaggacattgcgattaaggcatttaaagtcttgtgctgcgaaggcatggcgcgt
gtcgattgtttcttaacgccggagaatggtgttattgtcaatgaaatcaacacaataccc
ggctttacccgcatcagtatgtatccgaaactatgggaaatcagcggcattgcctacagt
gacttaattgacaggctgattcaactggctcttgagcgccatacccgggaacagagatta
caaacttcatatgcaaaaacctga

DBGET integrated database retrieval system