KEGG   Methylomusa anaerophila: MAMMFC1_01147Help
Entry
MAMMFC1_01147     CDS       T05819                                 

Gene name
yjmD
Definition
(GenBank) putative zinc-type alcohol dehydrogenase-like protein YjmD
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
mana  Methylomusa anaerophila
Pathway
mana00640  Propanoate metabolism
mana01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MAMMFC1_01147 (yjmD)
Enzymes [BR:mana01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     MAMMFC1_01147 (yjmD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: BBB90496
UniProt: A0A348AHE8
LinkDB All DBs
Position
complement(1298570..1299625)
Genome map
AA seq 351 aa AA seqDB search
MQGTMKALVYHGPENISLDEVPIPQIIKDDDAIVKVTTTTICGTDIHIWHGGVPEVESPR
ILGHEFCGEIIEIGSAVHNVKVGDRCAISCITQCGECFYCKQGIYSHCETGSWIFGYMID
GCQAEYVRVPHANLGCHIIPKELTDEDVLCVADILSTGYFGAENANIQPGETVLVSGCGP
VGMCAMAASRLWGPARVIAVDIIQERLDFAIKNGYADIALNPKNCDIVEQVKKLTYGRGA
DRCIEGVGAAPTLQLALDCVRPGGNVSVIGVFEKPFELAMNKLWIQNITLSMGLVNANRI
PFLIELIKTGKINMRPLITHHAPLNDILKGYDIFGGKKDNCIKWAVTPYEK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggaacaatgaaagctctggtctatcacggaccggaaaacatcagcttagatgaa
gtccctatcccgcagattatcaaagacgacgacgctattgtcaaagtaaccacaacgacc
atctgcggtaccgacattcacatctggcatggcggtgtaccagaggtcgaaagccctcgc
attctcggccacgaattttgcggcgagattatcgaaatcggctcagcagttcacaatgtc
aaagtcggcgacagatgcgctatctcctgtatcacccagtgcggtgaatgcttttattgt
aagcaagggatctattcccactgcgaaaccggcagttggatttttggctacatgattgac
ggttgccaggctgaatatgtccgtgtcccacatgcaaaccttgggtgccatattatccct
aaggagctcaccgatgaagacgtcttgtgtgttgcagacatcctttccactggctatttc
ggggctgaaaacgccaatattcagcctggtgaaaccgttttggtttccggttgcggccct
gtcggcatgtgcgctatggctgcctctaggttgtggggccccgcgcgggttattgctgtg
gacatcattcaggaaaggctggattttgccataaaaaacggttacgctgacatcgcgctg
aatcctaaaaactgcgatatcgttgaacaagtcaaaaagttgacttacggccgtggtgcg
gaccgctgcattgagggcgtcggtgctgctccgacccttcagctggctcttgactgtgtc
cggcctggaggtaacgtatctgtcatcggagtattcgaaaaaccatttgaattagccatg
aacaaactctggattcagaacataacattaagcatgggtctcgtaaatgccaatcgcatt
cctttcctgatcgaacttataaagacaggaaaaatcaacatgagaccccttattactcac
cacgctccactgaacgatattctgaaaggttacgacatatttggaggcaagaaagataat
tgcataaaatgggcagttactccttatgagaaataa

DBGET integrated database retrieval system