KEGG   Methylomusa anaerophila: MAMMFC1_02402Help
Entry
MAMMFC1_02402     CDS       T05819                                 

Gene name
glnH
Definition
(GenBank) glutamine-binding periplasmic protein precursor
  KO
K10036  glutamine transport system substrate-binding protein
Organism
mana  Methylomusa anaerophila
Pathway
mana02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mana00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MAMMFC1_02402 (glnH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mana02000]
    MAMMFC1_02402 (glnH)
Transporters [BR:mana02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamine transporter
    MAMMFC1_02402 (glnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: BBB91718
UniProt: A0A348AKX0
LinkDB All DBs
Position
2610489..2611280
Genome map
AA seq 263 aa AA seqDB search
MTKKTIALIVLTMFLLTLGLAGCGGQQAAKSAEQSAAKTLKVGSDTAFAPFEVQDEKTKE
YVGFDMDLIKALGKQMGIPVEVQSMNFDGLIPALEAGNIDMVISAMTITPERAQKVNFSK
PYYKSGLSMVVKSDNNTLKSFKDLEGKRIAVQIGTTGADEAKKIKDAKIREFNTAPEAFL
ELKAGGVDAVVNDLPVNEYYIAQAGGKDAKIVGEPLTSEDYGIATAKKNTELGNKINKAL
DELKQNGEYEKIYIKWFGKKPPQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaagaccattgctctcattgtattaaccatgttcctgttgaccttagggctt
gccggctgtggcgggcagcaggcagcaaaatcggcggagcagtctgcggctaaaacgctg
aaagtaggttcagacaccgcctttgctccgtttgaagtccaggatgaaaagaccaaggaa
tatgtcggttttgacatggacctgattaaagcccttggcaagcaaatgggaataccggtt
gaagttcaaagcatgaactttgatggtctcattccggcactggaagcgggaaatatcgac
atggttatttccgcgatgacgatcacgccggaacgggcacaaaaagtaaacttctccaaa
ccttactacaaatccggtttgtctatggtggtaaaaagcgacaataacacgctgaaatcc
tttaaagatttagagggtaagcggattgccgtacaaatcggtacaaccggcgccgacgaa
gcgaaaaagatcaaagacgctaaaatccgcgagttcaacactgctcccgaagcctttttg
gaacttaaagccggcggtgtagacgctgttgtgaatgacctgcctgtcaacgaatattat
attgctcaggccggcggcaaagacgccaagattgttggcgaaccgctcacttcggaagat
tatggtattgctactgccaagaaaaatactgaacttggcaacaagatcaacaaggccctt
gacgaactgaagcaaaatggggagtatgaaaaaatctacataaaatggttcggcaaaaaa
cctccccaataa

DBGET integrated database retrieval system