KEGG   Methylomusa anaerophila: MAMMFC1_03358Help
Entry
MAMMFC1_03358     CDS       T05819                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mana  Methylomusa anaerophila
Brite
KEGG Orthology (KO) [BR:mana00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MAMMFC1_03358 (ahpF)
Enzymes [BR:mana01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MAMMFC1_03358 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 FAD_binding_2 GIDA Pyr_redox FMO-like HI0933_like NAD_binding_7 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BBB92663
UniProt: A0A348ANL5
LinkDB All DBs
Position
3693062..3693940
Genome map
AA seq 292 aa AA seqDB search
MTAAVYAARKRMNAVLVTKEVGGQVMWTMDIENYMGYQFITGPELIAKFEEQVRQFPLKI
KYEEVNRLIVKDDGTFTVVSAEREYHSKTVIIASGKRPKRLGVPGEEEFAGRGVSYCATC
DGPLFAGKNVAVIGGGNSALQAAIELSQVADKVYLVARNNYNADPIVVEKLKKSNNIVEL
SGDTKGIQGSQSVEKLIIASLDSREETDLPVQGVFVEIGLMPNSEYCDGVVKLNDGGEIV
TDCRTRTKIPGLFAAGDVTNGPDKQIVIAAGDGAKAALVAYEYLLHKRPHCG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgctgtttatgccgcccgcaagcgtatgaatgccgtattggtgacaaaggaa
gtcggcggccaggtcatgtggacaatggacattgaaaactacatgggttatcagtttatt
accggacctgagctaatagcaaagttcgaggagcaggtccggcaatttccgttaaaaatt
aaatatgaagaagtgaacagactaatcgtgaaggatgacggcacttttaccgtagtgagc
gccgaaagggaatatcatagcaaaacggtaatcattgcctcaggcaagcgccctaaaagg
ctgggagtgccgggagaagaggagtttgccgggcggggggtcagttattgcgccacttgc
gacggacctttgtttgcaggcaaaaatgttgccgtcataggtggagggaactcggcgctg
caggcggcaatcgaattaagtcaagttgccgacaaagtatatcttgttgccagaaataat
tataatgccgatcccatcgtagtcgaaaaactaaaaaagagcaataacattgttgaactt
tcgggtgataccaagggtattcagggttcccagtcagtggaaaagctgataattgcaagt
ttagacagcagggaagaaacagatttgccggtacaaggggtttttgtagaaatcggactg
atgcctaactccgaatattgtgacggcgttgtcaaattgaatgacggtggggagattgtt
accgattgccgcacacggactaaaataccgggcctatttgctgccggcgacgtgacgaac
ggcccggacaaacaaatcgtaattgccgccggcgatggcgccaaagccgccctggttgct
tatgaatatctgttgcataaacgaccccattgcggataa

DBGET integrated database retrieval system