KEGG   Methylomusa anaerophila: MAMMFC1_03747Help
Entry
MAMMFC1_03747     CDS       T05819                                 

Gene name
prkC
Definition
(GenBank) serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mana  Methylomusa anaerophila
Brite
KEGG Orthology (KO) [BR:mana00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mana01001]
    MAMMFC1_03747 (prkC)
Enzymes [BR:mana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MAMMFC1_03747 (prkC)
Protein kinases [BR:mana01001]
 Serine/threonine kinases: Other
  Bacterial family
   MAMMFC1_03747 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 PIP49_C Kdo
Motif
Other DBs
NCBI-ProteinID: BBB93038
UniProt: A0A348APP0
LinkDB All DBs
Position
4060110..4061996
Genome map
AA seq 628 aa AA seqDB search
MLNRTLDNRYTIIERIGGGGMADVYRAHDKLLDRSVAVKVLRAQFTDDDEFVSRFRREAQ
AAAKLSHPNIVNIYDVGYEENTYYIVMEYISGETLKDKIEREAPLPVETAVRIAIEIAEA
LEHAHQNNLVHCDIKPHNILMTRAGRIKVTDFGIARAVTSATMTQSGTIIGSVHYFSPEQ
AKGSAVGAKSDIYSLGVVLYEMLTGTVPFSGETPISIALKHLQEEPRPIREFNPDIPPLI
EATVVKSMSKDPINRFTDISEMITDLKMSQNYLQDDRTRRLSRTDFPTQVLPQIPPTAAD
ADIPAGKRQNDVLAETSPKNKKVKPWLLGLALLLLVSAVAAYLGFGKFWSLNEVVVPDVV
GKQVDTARNILLSQNLRVVVSDSFSDKVPAGYVISQQPEAGTTVKEQRAVTLIISKGGET
TVVPDLRGINRRDAELQLQNAGLKLGRVDEQFSSDVAQDTVISQNPRPPAQVSKGTAIDI
VISKGAGPRKIVLPDFQGSSLNTVTTQLDSLKLKLGKVTETPNDKYPPGTIIGQNPLPAS
EVTEGSAIDFSVAKGISGAVRRASVQVTIPNGSPKQSLQIVVTDSNGRRIVYEGAHKPGE
KVEKTVEGVGQVRVQVYINDKLLQEQTI
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
ttgcttaatcgtacactggataatcgctatacaattatagaacgaatcggcggcggggga
atggctgacgtttaccgggcgcacgacaaattgcttgaccggtcggttgcggtaaaagtt
ctgcgcgcgcagttcaccgatgatgatgaattcgtaagccggtttcgcagagaagcccag
gccgcagccaaactttcccacccaaatattgtaaatatctatgacgttggttacgaagaa
aacacctactatatcgtcatggaatacatttcaggtgaaactctgaaagacaagattgag
cgggaagcgcctcttccggtggaaacggcagtccgtattgctatagaaatagcggaagcg
cttgaacatgcccatcaaaacaacctggtgcattgtgatataaaaccgcataatatctta
atgactcgtgcaggaagaataaaagttaccgattttggaattgccagggccgtgacgtcg
gccacaatgacccaatcgggtacaataatcggctctgtacactacttttcacccgaacag
gccaaaggctcggcagttggcgccaaatccgatatttactcactgggagtcgttttatac
gagatgctgacaggcactgtgcctttctccggcgaaacgccaattagcattgctcttaaa
cacctccaggaagaaccacgtcctatccgggaattcaaccccgatataccacctttaatt
gaggctaccgtagttaaatccatgtctaaggatccaattaaccggtttaccgacatcagt
gagatgatcaccgaccttaaaatgtcccaaaactatttgcaggatgatcgtaccagaaga
ctctcccgaacggattttcccactcaggttttgccgcagatcccgccaacagccgctgac
gctgatattcccgcaggaaaaaggcagaatgacgttctggctgaaacttcacctaaaaat
aaaaaagtaaaaccctggctgttaggtcttgctctgttgctgctggtatccgccgtggca
gcttatctgggttttggcaagttctggagccttaatgaagtggttgtaccggatgtagtc
ggcaaacaagtagatacagcccgcaatattttattgagtcaaaacttaagagtagtagtt
tcggattcttttagcgataaagtcccggccgggtacgtgatttctcaacaaccggaagcc
ggcacaactgtaaaagaacaacgcgccgttacgctcattataagcaaaggcggcgaaact
accgttgttcctgatctgagaggaataaaccgccgggacgccgaactgcaactacaaaac
gccgggttaaaactgggaagagtagatgagcagtttagttccgatgttgcccaggataca
gtaataagtcaaaatcccaggccgccggcgcaagtatccaaaggtactgcaattgacata
gtcatcagtaagggagccggtcctcggaaaatcgtgctgccggatttccaaggctcctct
cttaataccgttactacccagttagacagcctgaaattaaaactgggaaaagtaactgaa
actcctaacgataagtatccacccggtactatcatcgggcaaaatccactcccggcatcg
gaggtaacagaaggttctgccattgatttttcagttgcgaaaggaatatctggcgccgtc
aggcgggcgtccgttcaagtcaccattccgaatggatcgccgaaacagtcgcttcaaatc
gtagttactgattccaacggccgccgaattgtatatgaaggcgcgcataaacctggcgaa
aaagtggaaaaaaccgttgaaggtgttggccaagttcgggttcaagtctacattaacgat
aaactgttgcaagaacaaacaatttag

DBGET integrated database retrieval system