KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_0335Help
Entry
MAP4_0335         CDS       T02662                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur proteinsubunit SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00020  Citrate cycle (TCA cycle)
mao00190  Oxidative phosphorylation
mao00650  Butanoate metabolism
mao01100  Metabolic pathways
mao01110  Biosynthesis of secondary metabolites
mao01120  Microbial metabolism in diverse environments
mao01130  Biosynthesis of antibiotics
mao01200  Carbon metabolism
Module
mao_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mao_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mao_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAP4_0335
   00650 Butanoate metabolism
    MAP4_0335
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MAP4_0335
Enzymes [BR:mao01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MAP4_0335
    1.3.5.4  fumarate reductase (quinol)
     MAP4_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_10 Fer4_8 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_6 Fer4_4 Fer4_18 Fer4_16 Fer4_15 Fer4_2 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AGL35299
LinkDB All DBs
Position
complement(386654..387457)
Genome map
AA seq 267 aa AA seqDB search
MSVEPDVETLEPPLPPVPDEAVMVTVKIARFNPDQPDAYAETGGWQSFRVPCLPSDRMLN
LLIYIKSYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDLLPEPKKGKPGKPLT
ITVEPIRGLPVEKDLVVDMEPFFDAYRAVKPYLITTGNPPTRERIQSPADRARYDDTTKC
ILCAACTTSCPVFWHEGSYYGPAAIVNAHRFIFDSRDEGAAERLDILNEVDGVWRCRTTF
NCTDACPRGIEVTKAIQEVKRAIMFSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgagccggacgtcgaaaccttggaaccgccgctgccgccggttcccgacgaa
gcggtgatggtgaccgtcaagatcgcccggttcaaccccgaccagcccgacgcgtatgcg
gaaaccggtggctggcaaagctttcgggtgccgtgcctgcccagtgaccggatgctcaac
ctgctgatctacatcaagagctacctggacgggacgctgaccttccggcgttcctgcgcg
cacggggtgtgcggctcggacgccatgcgcatcaacggtgtcaaccggctggcgtgcaag
gtgctgatgcgcgatctgctgcccgagcccaagaagggcaagccgggcaagccgctgacc
atcacggtcgagccgatccgcgggctgccggtggaaaaggacctggtggtcgacatggag
ccgttcttcgacgcctaccgcgcggtcaagccgtacctgatcaccaccggcaatccgccc
acccgcgagcgcatccagagtccggccgaccgggcccgctacgacgacaccaccaagtgc
atcctgtgcgcggcatgcaccaccagctgcccggtcttctggcacgagggcagctactac
ggcccggccgcgatcgtcaacgcgcaccggttcatcttcgacagccgcgacgagggcgcc
gccgagcggctggacatcctcaacgaggtcgacggcgtgtggcgctgccgcaccacgttc
aactgcaccgatgcctgcccgcgcggcatcgaggtgaccaaggccatccaagaggtcaag
cgcgccatcatgttctcccgctga

DBGET integrated database retrieval system