KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_0552Help
Entry
MAP4_0552         CDS       T02662                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00380  Tryptophan metabolism
mao00630  Glyoxylate and dicarboxylate metabolism
mao01110  Biosynthesis of secondary metabolites
mao01130  Biosynthesis of antibiotics
mao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MAP4_0552
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MAP4_0552
Enzymes [BR:mao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MAP4_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AGL35511
LinkDB All DBs
Position
complement(617883..620003)
Genome map
AA seq 706 aa AA seqDB search
MATDHTSGAPDPKQRDLESARFRRDTGYLTTQQGVRVDHTDDALTVGERGPTLLEDFHAR
EKITHFDHERIPERVVHARGAGAYGYFEPYDDRLAQYTAAKFLTSPGTRTPVFVRFSTVA
GSRGSADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIP
QAQSAHDTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNARGEGTFVK
FHWKPRLGVHSLIWDECQKIAGKDPDYNRRDLWEAIESRQYPEWELGVQLVAEDDEFSFD
FDLLDATKIIPEEQVPVLPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQF
RNFSYLDTQLIRLGGPNFAQLPVNRPVAQVRTNQHDGYGQHTIPQGRSSYFKNSIGGGCP
ALADEDVFRHYTQRVDGQTMRKRAEAFQNHYGQARMFFKSMSPVEAEHIVAAFAFELGKV
EMPEIRSAVVAQLARVDDQLAAQVAAKLGLPEPPEEQVDESAPVSPALSQVTDGGDTIAS
RRIAVLAADGVDVVGTQRFTELMEQRGAVVEVLAPVAGGTLAGGSGGELRVDRSFTTMAS
VLYDAVVVACGPRSVSTLSDDGYAVHFVTEAYKHLKPIGAYGAGVDLLRKAGIDNRLAED
TDVLNDQAVVTTKAAADELPERFAEEFAAALAQHRCWQRRTDAVPA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaccacacttcgggtgcgcccgatcccaagcagcgcgatctggagtccgcg
cggttccgccgcgacaccggatacctgaccacgcagcagggcgtgcgcgtcgaccacacc
gacgatgcgctcaccgtcggcgagcggggtccgacgctgctggaggatttccacgcccgg
gagaagatcacccacttcgaccacgagcgcatcccggagcgtgtggtgcatgcgcgcggg
gccggcgcctacggctatttcgaaccgtacgacgaccggttggcgcagtacacggcggcg
aaatttctgacctcgccgggcaccaggacgccggtgttcgtgcgtttttcgacggtcgcc
ggatcgcgcggttcggccgacaccgtccgcgacgtgcgcgggttcgccaccaagttctat
accgaacaaggcaattacgacttggtgggcaacaacttcccggtgttcttcatccaggac
ggcatcaagttccccgacttcgtgcacgcggtgaaacccgagccgcacaacgagattccg
caggcgcagtcggcgcacgacacgctgtgggacttcgtgtcgctgcagcccgagacgttg
cacgccatcatgtggctgatgtcggaccgggcgctgccgcgcagctaccgcatgatgcag
gggttcggggtgcacaccttccggctggtgaacgcccgcggcgaggggactttcgtgaag
ttccactggaagccccgactcggcgtgcactcgctgatctgggacgaatgccagaagatc
gccggcaaagaccccgattacaaccgccgcgacctgtgggaggccatcgaatcccgccag
tacccggagtgggagctgggcgtgcagctggtcgccgaggacgacgagttcagcttcgac
ttcgatctgctggacgcgacgaaaatcattccggaagaacaggttccggtattgccggtg
ggcaagatggtgttgaaccgcaaccccgacaacttcttcgccgagaccgagcaggtcgct
tttcacaccgccaacgtggtgccgggcatcgatttcaccaacgacccgttgctgcagttc
cgcaacttctcctatctggacacgcagctgatccggttgggcggccccaacttcgcgcag
ctgccggtcaaccgcccggtggcgcaggtgcggaccaaccagcacgacggttacgggcag
cacacgattccgcagggccggtccagttacttcaagaacagcatcggcggcggttgtccc
gcactggccgacgaggacgtgttccggcactacacccagcgggtggacgggcagacgatg
cgcaagcgcgccgaggcgttccagaaccactacggccaggcgcggatgttcttcaagagc
atgtcgccggtggaggccgaacacatcgtggccgccttcgccttcgaactcggcaaggtg
gagatgcccgaaatccgttccgcggtggtggcacaactcgcccgcgtcgatgaccagctg
gccgcccaggtcgcggcgaaactggggctgcccgagccgccggaggagcaggtggacgag
tcggcaccggtttccccggcgctttcgcaggtcaccgacggcggcgacaccatcgcgtcg
cgccggatcgcggtgctggccgccgacggcgtcgacgtggtgggcacgcaacgcttcacc
gagctgatggagcagcgcggcgcggtggtcgaggtgctggccccggtggccggcggcacg
ctggcgggtgggtccggcggcgagctgcgggtggaccggtccttcacgacgatggcgtcg
gtgctctacgacgcggtggtggtggcgtgcggaccgcggtcggtgtcgacgctgtccgac
gacggctacgccgtgcacttcgtcaccgaggcctacaaacacctcaagccgatcggcgcc
tacggggccggtgtcgacctgctccgcaaggccggcatcgacaaccggctcgccgaggac
accgacgtgctcaacgaccaagcggtggtcaccaccaaggccgccgccgacgagctgccc
gagcgcttcgccgaggaattcgccgccgcgctcgcgcagcaccggtgctggcagcggcgc
accgacgcggtgccggcctga

DBGET integrated database retrieval system