KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_2117Help
Entry
MAP4_2117         CDS       T02662                                 

Definition
(GenBank) fatty oxidation protein FadB
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00071  Fatty acid degradation
mao00280  Valine, leucine and isoleucine degradation
mao00281  Geraniol degradation
mao00310  Lysine degradation
mao00362  Benzoate degradation
mao00380  Tryptophan metabolism
mao00410  beta-Alanine metabolism
mao00640  Propanoate metabolism
mao00650  Butanoate metabolism
mao00903  Limonene and pinene degradation
mao00930  Caprolactam degradation
mao01100  Metabolic pathways
mao01110  Biosynthesis of secondary metabolites
mao01120  Microbial metabolism in diverse environments
mao01130  Biosynthesis of antibiotics
mao01200  Carbon metabolism
mao01212  Fatty acid metabolism
Module
mao_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MAP4_2117
   00650 Butanoate metabolism
    MAP4_2117
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MAP4_2117
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP4_2117
   00310 Lysine degradation
    MAP4_2117
   00380 Tryptophan metabolism
    MAP4_2117
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAP4_2117
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAP4_2117
   00281 Geraniol degradation
    MAP4_2117
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP4_2117
   00930 Caprolactam degradation
    MAP4_2117
Enzymes [BR:mao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MAP4_2117
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAP4_2117
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MAP4_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 F420_oxidored 2-Hacid_dh_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGL37023
LinkDB All DBs
Position
complement(2333652..2335784)
Genome map
AA seq 710 aa AA seqDB search
MSDSIIGWDKDADGIVTLTIDDPDNSANMLTDAYVEQMGAMIDRLEAEVDETTGVVITSG
KSTFFAGADLTQIRSAGPEHAQQLFDGSTAIKRDLRRLETLGKPVVAAINGAALGGGLEL
ALATHHRIAANVAGSVIGLPEVMLGVLPGAGGVARSVRLLGIQNALMQVLLTGNRFKPAK
AQQVGLVDELVESVDELVPAAKAWILANPGKHVQPWDVPGFEIPGGSPSTPAFAANLPAF
PANLRKQLKGSPMPAPRAIMAAALEGAQVDFDTAQLIETRYFVNLVTGPIAKNMIQAFFF
DLQAVQSGTSRPADAPERTIHKVGILGAGMMGAGIAYVTAKAGIDVVLKDVTLQAARKGK
AYSENLEQKALAKGRTTEAKSRALLDRITPTADAADFTGVDFVIEAVFENTELKNKVFAE
IENIVEPGAVLGSNTSSLPITELAAGVSRPENFVGIHFFSPVEKMDPIEIIRGAKTSDET
LARVIDYTLAINKYPIVVNDGRGFFTTRVFSTYLLEAFNMLAEGIDPATIEQAALQAGYP
AGPLQVADELSFGTIRKIMDETVQAAKADGVALDESVRVAAEVVTTLMDTFDRTGKKGGA
GFYDYVDGTRAGLWDDLRKAFNTTRALSVPFDDLQDRYLFIQAIETQKAYDDGVISSDPD
ANIGSIFSIGYPPWTGGVRQFVTGYPGGIDAFRRRADELAARYGGRFRWI
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgacagcattattggctgggacaaggacgccgacgggatcgtcacgctgacgatc
gacgaccccgacaacagcgccaacatgctcaccgatgcctacgtcgagcagatgggcgcg
atgatcgaccggctcgaggccgaggtcgacgagaccaccggtgtggtgatcacctcgggt
aagtccacgtttttcgccggcgccgatctgacccagatccgcagcgccggacccgagcac
gcgcagcaactgttcgacggctccacggcgatcaaacgtgatctgcgtcggctggagacg
ctgggcaaaccggtcgtcgccgcgatcaacggcgccgcgttgggcggcgggctggagctg
gcgctggccacccatcaccgcatcgcggccaacgtggcgggcagcgtgatcggtctgccc
gaagtgatgctgggtgtgctacccggcgccggcggcgtggcgcgcagcgtgcggctgctc
ggcatccaaaacgcgctgatgcaggtgttgttgaccggcaaccgattcaagcccgccaag
gcccaacaggtcggcctcgtcgacgaactggtcgagtccgtcgacgaattggtgccggcc
gccaaggcgtggatcctggccaacccgggcaagcatgtgcagccgtgggacgttccgggt
ttcgagattcccgggggcagcccgtccacaccggcgtttgcggccaacctgccggcgttc
ccggccaacttgcgcaagcagctcaagggctcgccgatgccggcgccgcgagcaatcatg
gcggccgcactcgaaggggcccaggtcgacttcgacaccgcccagctcatcgagacgcgc
tacttcgtcaacctggtcaccggcccgatcgccaagaacatgattcaggcgttcttcttc
gatctgcaggccgtgcagagcgggacgtcgcgccccgccgatgcgcccgagcgcacaatc
cacaaggtcggcatcctgggcgcgggcatgatgggcgccgggatcgcatatgtcacagcg
aaagccggcatcgacgtcgtcctcaaagacgtcacgctgcaggcggcccgcaagggcaag
gcgtattcggaaaacctcgagcagaaggcattggcgaaaggccgtaccaccgaggcgaag
tcgcgggcgctgctggaccgcatcaccccgaccgccgacgccgccgacttcaccggcgtg
gatttcgtgatcgaggcggtgttcgaaaacaccgagctgaagaacaaggtgttcgccgag
atcgagaacatcgtcgaacccggcgccgtgctgggctccaacacctcgtcgctgccgatc
accgagctggccgccggggtgagtcgcccggagaacttcgtcggcatccacttcttctca
ccggtggaaaagatggacccgatcgagatcatccgcggcgcaaagacatccgacgagacc
ctggcccgggtcatcgactacacgctggccatcaacaagtaccccatcgtggtcaacgac
ggccgcgggttcttcaccacccgggtgttctccacctacctgctcgaggccttcaacatg
ctcgccgaaggcatcgacccggccaccatcgaacaggcggcgcttcaggccggctacccg
gccgggccgctgcaagtggccgacgagctcagcttcggcaccatccgcaagatcatggat
gagacggtgcaggcggccaaggccgacggcgtggcgctcgacgagtcggtgcgcgtggcc
gccgaggtggtcaccacgctgatggacacgttcgaccgcaccggcaaaaagggcggcgcg
ggtttctacgactacgtcgacggcacccgcgccgggttgtgggacgatctgcgaaaggca
ttcaacaccacacgcgcactgtcggttccgttcgacgacctgcaggaccgctacctgttc
atccaggcgatcgaaacgcaaaaggcttacgacgacggcgtcatcagctccgacccggac
gccaacatcggctcgatcttcagcatcggctacccgccgtggaccggcggagtgcgccag
ttcgtcaccggctatccgggcgggatcgatgcgttccgccggcgcgccgatgaactcgcc
gcaaggtatggagggcgattccgatggatctga

DBGET integrated database retrieval system