KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_2684Help
Entry
MAP4_2684         CDS       T02662                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00620  Pyruvate metabolism
mao00680  Methane metabolism
mao01100  Metabolic pathways
mao01120  Microbial metabolism in diverse environments
mao01200  Carbon metabolism
Module
mao_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAP4_2684
  Energy metabolism
   00680 Methane metabolism
    MAP4_2684
Enzymes [BR:mao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MAP4_2684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AGL37570
LinkDB All DBs
Position
complement(2980180..2982987)
Genome map
AA seq 935 aa AA seqDB search
MVEASEGTLEPIGAVQRTLVGREATEPMRADIRLLGAILGDTVREQNGQQVFELVERARV
ESFRVRRSEIDRAELARMFAGIDIHQAIPVIRAFSHFALLANVAEDIHRERRRAIHVAAG
EPPQDSSLAATYAKLDRAQLDSAMVAEALRGAVVSPVITAHPTETRRRTVFVTQHRITEL
MRLHAEGHTETDDGRNIELELRRQVLTLWQTALIRLSRLQITDEIEVGLRYYAAAFFKVI
PQVNAEVRNALRARWPGADLLDEPIVAPGSWIGGDRDGNPNVTADVVRRATGDAAYTALA
HYLAELTACEQELSMSARLVAVTPELAALAEDCAEKARADEPYRRALRVIRGRLTATAAE
ILDRRPQHELDLGLPPYATPAELRADLDTVDASLRAHGSALLADDRLALLREGVRVFGFH
LCGLDMRQNSDVHEEVVAELLAWAGVHPDYRSLPEDERVELLAAELGTRRPLVGDRAELS
ELADKELGVVRAAAHAIRRYGPAAVPNYVISMCRSVSDVLEAAILLKEAGLIDASGPEPY
CPVGISPLLETIEDLHNGAAILHAMLELPLYRALVAARGQSQEVMLGYSDSNKDGGYLAS
SWAVYRAELALVEVARKIGIRLRLFHGRGGTVGRGGGPSYEAILAQPPGAVNGSLRLTEQ
GEVIAAKYAEPQVAQRNLESLVAATLESTLLDVEGLGDTAEPAYAVLDEVAVLAQRAYAE
LVHETPGFVDYFMASTPVSEIGSLNIGSRPTSRKPTESIADLRAIPWVLAWSQSRVMLPG
WYGTGSAFEQWIAAGPQSRAERVDILHDLYRRWPFFRSVLSNLAQVLAKSDLGLAAQYAE
LVDDAALRRRVFGKIADEHRRTIAMHKLITGQDNLLADNPALARSVFNRFPYLEPLNHLQ
VELLRRYRSGDDDELVQRGILLTMNGLASALRNSG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggcatccgagggcacgctggaaccgatcggcgccgtccagcgcaccctggtg
gggcgcgaggccaccgagccgatgcgggccgacattcggctgctcggcgccatcctgggc
gacacggtgcgcgagcagaacggccagcaggtgttcgagctcgtcgaacgcgcccgggtg
gaatcgttccgggtgcggcgctccgagatcgaccgggccgagctggcccggatgttcgcg
ggcatcgacatccaccaggccatcccggtcatccgcgccttcagccacttcgcgctgctg
gccaacgtcgccgaggacatccaccgggagcgccgccgggcgatccacgtcgccgccggc
gaaccgccgcaggacagcagcctggccgccacctacgccaaactcgatcgcgcacaactg
gattcggccatggtggccgaggcgctgcggggcgcggtggtgtccccggtgatcaccgcc
caccccactgagacccggcggcgcaccgtcttcgtcacccagcaccggatcaccgagctg
atgcggctgcacgccgaagggcacaccgaaaccgacgacggccgcaacatcgagctggag
ctgcgccgccaggtcctcacgctgtggcagaccgcgctgatccggctgtcccgcctgcag
atcaccgacgagatcgaggtggggctgcgctactacgccgccgccttcttcaaggtcatc
ccgcaggtcaacgccgaggtccgcaacgcgctgcgggcccgctggcccggcgccgacctg
ctcgacgagccgatcgtggcacccggctcctggatcggcggcgaccgcgacggcaacccc
aacgtgacggccgacgtggtgcgccgggccaccggcgacgccgcctacaccgcgctggcg
cactacctggccgagctgaccgcctgcgagcaggagctgtcgatgtcggcgcgcctggtc
gcggtcacccccgagctggccgcgctggccgaggactgcgccgagaaggcccgcgccgac
gagccgtaccggcgggcgctgcgggtgatccgcggccggctcaccgccaccgccgccgag
atcctggaccgccgaccgcaacacgagctggacctgggtttgccgccgtacgccacgccg
gccgaactgcgggccgacctcgacaccgtcgacgcgtcgttgcgcgcgcacggcagcgcg
ctgctggccgacgaccgcctggccctgctgcgagaaggcgtgcgggtcttcgggtttcac
ctgtgtggcctggacatgcggcagaactccgacgtgcacgaggaagtggtggccgagctg
ctggcctgggcgggcgtgcacccggactaccggtcgctgcccgaggacgagcgggtggag
ctgctggcggccgagctgggcacccgccggccgctggtcggggaccgcgcggaactgtcc
gagctggccgacaaggagctgggtgtggtgcgcgcggcggcgcacgccatccggcggtac
ggcccggccgccgtgcccaactacgtcatctcgatgtgccgctcggtctccgatgtgctc
gaggccgcgatcctgctcaaagaggcggggctgatcgacgcgtcgggccccgaaccctat
tgcccggtgggcatctcaccgctgctcgagaccatcgaggacctgcacaacggcgcggcg
atcctgcacgcgatgctcgagctcccgctgtaccgggcgttggtggccgcccgcggacag
agccaggaggtgatgctgggctactccgactccaacaaggacggcgggtacctggcgtcg
agctgggcggtgtaccgcgccgagctggcgctggtcgaggtggcccgcaaaatcggaatc
cggttgcggctcttccacggtcgcggcggcaccgtcgggcgcggcggcggaccgagctac
gaagcgatcctggcgcagccccccggcgcggtgaacggctcgctgcggctcaccgagcag
ggcgaggtgatcgccgccaaatacgccgaaccccaagtggcgcaacgcaatctggaaagc
ctggtggccgccacgctggagtcgacgctgctcgacgtcgagggcctgggcgacaccgcc
gaacccgcgtatgccgtgctcgacgaggtggcagtgctggcgcagcgcgcctacgccgaa
ttggtgcacgagacaccgggtttcgtggactacttcatggcctccaccccggtcagcgag
atcggctcgctgaacatcggcagccggcccacctcacgcaagcccaccgagtccatcgcg
gatttgcgcgccattccctgggtgctggcctggagtcagtcccgggtgatgctgcccggt
tggtacggcaccggttcggcgttcgagcagtggatcgcggccggcccgcagagccgggcc
gagcgggtcgacatcctgcacgacctgtaccgtcgctggccgttcttccgcagcgtgctg
tcgaacctggcccaggtgctggccaaaagtgacctgggcctggccgcgcagtacgccgag
ctggtcgacgacgcggcactgcggcggcgggtgttcggcaagatcgccgacgagcaccgc
cgcaccatcgccatgcacaagctgatcaccggccaggacaacctgctcgccgacaacccc
gcgctggcgcgttcggtgttcaaccgcttcccctacctcgagccgctcaaccacctgcag
gtggagctgctgcgccgctaccgcagcggcgacgacgacgaactggtgcagcgcggcatc
ctgctgacgatgaacggactggccagcgcgctgcgaaacagcggctga

DBGET integrated database retrieval system