KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0535Help
Entry
Maqu_0535         CDS       T00454                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00330  Arginine and proline metabolism
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01130  Biosynthesis of antibiotics
maq01230  Biosynthesis of amino acids
Module
maq_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Maqu_0535
Enzymes [BR:maq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Maqu_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_Gly3P_dh_N PDH Shikimate_DH GFO_IDH_MocA ApbA NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABM17636
UniProt: A1TY17
LinkDB All DBs
Position
complement(607703..608536)
Genome map
AA seq 277 aa AA seqDB search
MSRSPTISFIGAGNMASAIIGGMLDSGFQAGDIWVSAPDDGHLQSIRKRFGVSVTTDNRY
CAQQADIVVLAVKPQVMGDVCRDIAPVVQNTRPLMVSIAAGLTAGTLDTWLGGGLPLVRV
MPNTPSLVGKGAAGLFANSQVKDDQRNAVQKVFESIGSALWVDDENLLHSVTALSGSGPA
YFFLMLEALESAATEAGIESETARALAIQTMAGAAEMAARSEDDPGQLKRNVMSPGGTTE
RAINTFEEGGLRDLVKKAYSAAFERSREMSRELADKQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgagcagatcacccaccatctctttcatcggcgccggcaacatggccagcgccatcatc
ggcggtatgctggatagcggatttcaggccggcgacatctgggtgagcgccccggatgac
ggccatcttcagtcaattcgcaaacgtttcggcgtcagcgtcacaaccgacaaccgctat
tgcgcccaacaggcggacattgtggtgctcgcggtcaaaccccaggtgatgggcgacgtc
tgccgggacattgccccggtagttcagaacacccgcccgctgatggtttccattgcggcc
gggctgacggccggcacactagatacctggcttggtggcgggctgccactggttcgggtg
atgcccaacactccgtctctggtgggcaaaggtgccgccggtctgttcgccaacagccag
gtgaaagacgatcaaagaaatgcggtacagaaagtgttcgagagcatcggctcggcactg
tgggttgacgacgaaaaccttctgcacagtgtcaccgccctttccggcagcggccccgct
tatttcttcctgatgctggaagcacttgagtccgccgcaaccgaagccggcattgagtcc
gaaacggctcgcgccctcgccattcagaccatggccggggccgccgagatggccgcgcgc
agcgaggatgaccccggccagctcaaacgcaacgtgatgtcccctggcggcaccactgaa
cgcgccatcaacaccttcgaggaaggcggcctgcgcgatctggtgaaaaaagcctacagc
gctgccttcgagcgctcacgcgagatgtccagagaactggccgataaacagtaa

DBGET integrated database retrieval system